| PDBID: | 9f7g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8y4n | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Human MRP2 in inward-facing conformation bound with ATPgammaS | | Authors: | Fan, W., Shao, K., Luo, M. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8jxs | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-01 | | Release date: | 2025-01-01 |
|
| PDBID: | 8y4l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-30 |
|
| PDBID: | 9f7k | | Status: | HPUB -- hold until publication | | Title: | Glutathione transferase epsilon 1 from Drosophila melanogaster in complex with glutathione | | Authors: | Didierjean, C., Schwartz, M., Neiers, F. | | Deposition date: | 2024-05-03 | | Sequence: | >Entity 1
MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKEINEAPAQSYVAFLRSKWTKLGDK
|
|
| PDBID: | 8jxy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | lysozyme with in situ device | | Authors: | Liang, M., Wang, Q. | | Deposition date: | 2023-07-01 | | Release date: | 2025-01-01 |
|
| PDBID: | 9f7j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8y4k | | Status: | HPUB -- hold until publication | | Title: | Metal Beta-Lactamase VIM-2 in Complex with MBL inhibitor B17 | | Authors: | Li, G.-B., Wang, S.-Y. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 9f7p | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8y4o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Human MRP2 in occluded conformation bound with ATPgammaS | | Authors: | Fan, W., Shao, K., Luo, M. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 9f7q | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8y4p | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Human MRP2 in inward-facing conformation bound with Methotrexate and ATPgammaS | | Authors: | Fan, W., Shao, K., Luo, M. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8pox | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal Structure of the C19G variant of the membrane-bound [NiFe]-Hydrogenase from Cupriavidus necator in the H2-reduced state at 1.6 A Resolution. | | Authors: | Kalms, J., Schmidt, A., Scheerer, P. | | Deposition date: | 2023-07-05 |
|
| PDBID: | 9f7r | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8y4q | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Human MRP2 in occluded conformation bound with Methotrexate and ATPgammaS | | Authors: | Fan, W., Shao, K., Luo, M. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8poy | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal Structure of the C120G variant of the membrane-bound [NiFe]-Hydrogenase from Cupriavidus necator in the air-oxidized state at 1.93 A Resolution. | | Authors: | Schmidt, A., Kalms, J., Scheerer, P. | | Deposition date: | 2023-07-05 |
|
| PDBID: | 9f7s | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S-K191D-K229R mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8y4r | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Human MRP2 in inward-facing conformation bound with Oxaliplatin and ATPgammaS | | Authors: | Fan, W., Shao, K., Luo, M. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8poz | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal Structure of the C120G variant of the membrane-bound [NiFe]-Hydrogenase from Cupriavidus necator in the H2-reduced state at 1.65 A Resolution. | | Authors: | Schmidt, A., Kalms, J., Scheerer, P. | | Deposition date: | 2023-07-05 |
|
| PDBID: | 9f7t | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S-K191D-K229R mutant: dimer | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8y4s | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Human MRP2 in inward-facing conformation bound with Lansoprazole and ATPgammaS | | Authors: | Fan, W., Shao, K., Luo, M. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 9f7o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8y4t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Human MRP2 bound with Methotrexate in vanadate-trapped state | | Authors: | Fan, W., Shao, K., Luo, M. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8jzq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-06 | | Release date: | 2025-01-06 |
|
| PDBID: | 9f7l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-04 |
|
