| PDBID: | 8y1t | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF TRYPANOSOMA BRUCEI GAMBIENSE GLYCEROL KINASE COMPLEX WITH ADP and G3P | | Authors: | Balogun, E.O., Inaoka, D.K., Ichinose, M., Chishima, T., Harada, S., Kita, K., Shiba, T. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 9f5z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8y1v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8jtq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-22 | | Release date: | 2024-12-22 |
|
| PDBID: | 9f60 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8y1w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Thermococcus pacificus dUTPase complexed with dUMP. | | Authors: | Fukui, K., Murakawa, T., Yano, T. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8jtu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-22 | | Release date: | 2024-09-24 |
|
| PDBID: | 9f61 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8y2l | | Status: | HOLD -- hold until a certain date | | Title: | The Crystal Structure of Glucosyltransferase TcdB from Clostridioides difficile | | Authors: | Fan, S., Wei, X., Lv, R., Wang, C., Tang, M., Jin, Y., Yang, Z. | | Deposition date: | 2024-01-26 | | Release date: | 2025-01-26 |
|
| PDBID: | 9f67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8y2i | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of dLesCas12e-sgRNA-dsDNA | | Authors: | Zhang, S., Lin, S., Liu, J.J.G. | | Deposition date: | 2024-01-26 |
|
| PDBID: | 9f68 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Interleukin-31 in complex with Oncostatin-M receptor | | Authors: | Bloch, Y., Savvides, S.N. | | Deposition date: | 2024-04-30 | | Release date: | 2025-10-30 |
|
| PDBID: | 9f5w | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8y2j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8jum | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-26 | | Release date: | 2024-12-31 |
|
| PDBID: | 9f62 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8y2o | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8pkn | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of catalytic domain of human HMG-CoA reductase with its inhibitor atorvastatin | | Authors: | Manikandan, K., Van Rooyen, J. | | Deposition date: | 2023-06-27 | | Release date: | 2025-01-03 |
|
| PDBID: | 9f5q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8y2k | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of QX006N-Fab | | Authors: | Li, W., Feng, W. | | Deposition date: | 2024-01-26 |
|
| PDBID: | 9f5u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Heme-Oxygenase from Corynebacterium diphtheriae complexed with Cobalt-porphyrine (HumO-Co(III)) | | Authors: | Labidi, R.J., Faivre, B., Carpentier, P., Perard, J., Gotico, P., Li, Y., Atta, M., Fontecave, M. | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8y2m | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-26 | | Release date: | 2025-01-26 |
|
| PDBID: | 9f5v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiol peroxidase from Helicobacter pylori (HpTx, reduced) | | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
| PDBID: | 8y2v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phospholipase C2 | | Authors: | Zhu, D. | | Deposition date: | 2024-01-27 |
|
| PDBID: | 9f64 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiol peroxidase mutant (C94A) in complex with Metro* (H. pylori | | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQIAGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
