| PDBID: | 8qi2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8u4y | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F Mutant | | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8u52 | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of human transthyretin conjugated to the stilbene substructure derived from reaction with the fluorogenic covalent kinetic stabilizer A2 | | Authors: | Yan, N.L., Nugroho, K., Kline, G.M., Basanta, B., Lander, G.C., Wilson, I.A., Kelly, J.W. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8wc1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-11 | | Release date: | 2024-09-11 |
|
| PDBID: | 8wc2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 | | Release date: | 2025-03-11 |
|
| PDBID: | 8wc0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of EcThsA | | Authors: | Chen, Q., Yu, Y. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qj1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-12 | | Release date: | 2024-09-12 |
|
| PDBID: | 8qiz | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of Paradendryphiella salina PL7C alginate lyase mutant H124 soaked with with penta-mannuronic acid | | Authors: | Wilkens, C. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Levansucrase beta from Pseudomonas syringae pv. actinidiae | | Authors: | Ferraroni, M., Peritore, L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qie | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME : LM32Cs1C1 mutant snoRNA overexpression, class 4 | | Authors: | Rajan, K.S., Yonath, A., Bashan, A. | | Deposition date: | 2023-09-12 | | Release date: | 2024-12-09 |
|
| PDBID: | 8qj2 | | Status: | HPUB -- hold until publication | | Title: | Structure of active state MC4R in complex with a potent ligand mimicking nanobody | | Authors: | Busch, A., Jaakola, V.-P., Masiulis, S. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cytochrome domain 1 from PgcA | | Authors: | Nash, B.W., Edwards, M.J., Clarke, T.A. | | Deposition date: | 2023-09-12 | | Release date: | 2024-12-12 |
|
| PDBID: | 8qj9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of human IDO1 bound to Compound 23 | | Authors: | Steinbacher, S., Lammens, A., Harris, S.F. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u59 | | Status: | HPUB -- hold until publication | | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-12 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8u54 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u56 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u58 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
