| PDBID: | 8psw | | Status: | HPUB -- hold until publication | | Title: | ERK2 covalently bound to RU67 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8psy | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU68 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pst | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU60 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt1 | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU76 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt3 | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU77 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt5 | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU187 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt8 | | Status: | HPUB -- hold until publication | | Title: | JNK1 covalently bound to RU135 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8psr | | Status: | HPUB -- hold until publication | | Title: | ERK2 covalently bound to SynthRevD-12-opt artificial peptide | | Authors: | Sok, P., Poti, A., Gogl, G., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt9 | | Status: | HPUB -- hold until publication | | Title: | JNK1 covalently bound to BD838 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pta | | Status: | HPUB -- hold until publication | | Title: | JNK1 covalently bound to BD837 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8k2u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-13 | | Release date: | 2025-01-13 |
|
| PDBID: | 8ps3 | | Status: | PROC -- to be processed | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt0 | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU75 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BG505 SOSIP trimer purified via Galanthus nivalis lectin chromatography | | Authors: | Parsons, R.J., Pothula, K., Acharya, P. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of 1059 SOSIP trimer purified via Galanthus nivalis lectin chromatography | | Authors: | Pothula, K., Parsons, R.J., Acharya, P. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgx | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgs | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of the post-reactive state of UDP-sugar pyrophosphorylase from Leishmania major in complex with product UDP-Glucose and by-product analog VO4 (orthovanadate) | | Authors: | Prakash, O., Fuehring, J.I., Baruch, P., Routier, F.H., Fedorov, R. | | Deposition date: | 2023-07-13 | | Release date: | 2025-01-13 |
|
| PDBID: | 8tgz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8ptd | | Status: | HPUB -- hold until publication | | Title: | The surface-exposed lipo-protein of BtuG1 in complex with cyanocobalamin. | | Authors: | Whittaker, J., Felices Martinez, J.M., Guskov, A., Slotboom, D.J. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8pts | | Status: | HPUB -- hold until publication | | Title: | human GUK1 in complex with compound AT8001 | | Authors: | Zimberger, C., Canard, B., Ferron, F. | | Deposition date: | 2023-07-14 | | Sequence: | >Entity 1
MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
|
|
| PDBID: | 8ptt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8k32 | | Status: | HPUB -- hold until publication | | Title: | The complex structure of SLKARI with NADH at 2.12-angstrom resolution | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8k30 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 | | Release date: | 2025-01-14 |
|
