| PDBID: | 8x4t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 9ewr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8x48 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (EGTA) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8oef | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-10 | | Release date: | 2024-10-13 |
|
| PDBID: | 9ews | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Optimisation of Potent, Efficacious, Selective and Blood-Brain Barrier Penetrating Inhibitors Targeting EGFR Exon20 Insertion Mutations | | Authors: | Hargreaves, D. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8x49 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (100 nM Ca2+) | | Authors: | Chen, Q., Hu, H. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8oeq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-12 | | Release date: | 2024-09-12 |
|
| PDBID: | 9ewt | | Status: | HPUB -- hold until publication | | Title: | Optimisation of Potent, Efficacious, Selective and Blood-Brain Barrier Penetrating Inhibitors Targeting EGFR Exon20 Insertion Mutations | | Authors: | Hargreaves, D. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8x4c | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (20 uM Ca2+, 2 mM ATP) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 9ewu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8x4v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8of8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-14 | | Release date: | 2024-09-14 |
|
| PDBID: | 9ewz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the E. coli BrxX methyltransferase in complex with DNA | | Authors: | Adams, M.C., Ghilarov, D. | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8x44 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8ofi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-15 | | Release date: | 2024-09-15 |
|
| PDBID: | 9ex5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8x45 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8ofz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-17 | | Release date: | 2024-09-17 |
|
| PDBID: | 9ex8 | | Status: | HPUB -- hold until publication | | Title: | Free form of a mutant of SARS-CoV-2 main protease Mpro. | | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8x46 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8ofy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-17 | | Release date: | 2024-09-17 |
|
| PDBID: | 9eww | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8x47 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8ofx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-17 | | Release date: | 2024-09-17 |
|
| PDBID: | 9er5 | | Status: | HPUB -- hold until publication | | Title: | Hydrogenase-1 Ni-B state poised at +100mV | | Authors: | Carr, S.B., Li, W., Wong, K.l., Ash, P.A., Vincent, K.A. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
LENKPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRVVDIPRSHHHHHH
>Entity 2
MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERICGVCTGVHALASVYAIEDAIGIKVPDNANIIRNIMLATLWCHDHLVHFYQLAGMDWIDVLDALKADPRKTSELAQSLSSWPKSSPGYFFDVQNRLKKFVEGGQLGIFRNGYWGHPQYKLPPEANLMGFAHYLEALDFQREIVKIHAVFGGKNPHPNWIVGGMPCAINIDESGAVGAVNMERLNLVQSIITRTADFINNVMIPDALAIGQFNKPWSEIGTGLSDKCVLSYGAFPDIANDFGEKSLLMPGGAVINGDFNNVLPVDLVDPQQVQEFVDHAWYRYPNDQVGRHPFDGITDPWYNPGDVKGSDTNIQQLNEQERYSWIKAPRWRGNAMEVGPLARTLIAYHKGDAATVESVDRMMSALNLPLSGIQSTLGRILCRAHEAQWAAGKLQYFFDKLMTNLKNGNLATASTEKWEPATWPTECRGVGFTEAPRGALGHWAAIRDGKIDLYQCVVPTTWNASPRDPKGQIGAYEAALMNTKMAIPEQPLEILRTLHSFDPCLACSTH
|
|
