PDBID: | 8z1v | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-12 |
|
PDBID: | 8z1w | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-12 |
|
PDBID: | 8z2c | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-12 |
|
PDBID: | 8z1x | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-12 |
|
PDBID: | 8z1y | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-12 |
|
PDBID: | 8z1z | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-12 |
|
PDBID: | 8z21 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-12 |
|
PDBID: | 8z23 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Nur77 LBD in complex with DBIC compound | Authors: | Hong, W.B., Lin, T.W., Chen, X.Q., Wu, Q. | Deposition date: | 2024-04-12 |
|
PDBID: | 8z2b | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-12 |
|
PDBID: | 8z26 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-12 |
|
PDBID: | 8z29 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-12 |
|
PDBID: | 8z2d | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-12 |
|
PDBID: | 8z2i | Status: | HPUB -- hold until publication | Title: | Substrate analog a011 bound form of PET-degrading cutinase mutant Cut190**SS_S176A | Authors: | Numoto, N., Kondo, F., Bekker, G.J., Liao, Z., Yamashita, M., Iida, A., Ito, N., Kamiya, N., Oda, M. | Deposition date: | 2024-04-12 |
|
PDBID: | 8z2j | Status: | HPUB -- hold until publication | Title: | Substrate analog a012 bound form of PET-degrading cutinase mutant Cut190**SS_S176A | Authors: | Numoto, N., Kondo, F., Bekker, G.J., Liao, Z., Yamashita, M., Iida, A., Ito, N., Kamiya, N., Oda, M. | Deposition date: | 2024-04-12 |
|
PDBID: | 8z2k | Status: | HPUB -- hold until publication | Title: | Substrate analog a013 bound form of PET-degrading cutinase mutant Cut190**SS_S176A | Authors: | Numoto, N., Kondo, F., Bekker, G.J., Liao, Z., Yamashita, M., Iida, A., Ito, N., Kamiya, N., Oda, M. | Deposition date: | 2024-04-12 |
|
PDBID: | 8z2l | Status: | HPUB -- hold until publication | Title: | Crystal structure of trehalose synthase mutant N253E from Deinococcus radiodurans | Authors: | Ye, L.C., Chen, S.C. | Deposition date: | 2024-04-12 |
|
PDBID: | 8z2a | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdl | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdn | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdq | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdp | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-04-12 |
|
PDBID: | 9bdm | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-04-12 | Release date: | 2025-04-12 |
|
PDBID: | 9bdr | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of cardiac amyloid fibril from a variant ATTRV122delta, double filament morphology 1 | Authors: | Nguyen, B.A., Ahmed, Y., Saelices, L. | Deposition date: | 2024-04-12 | Release date: | 2025-04-12 |
|
PDBID: | 9bdo | Status: | HPUB -- hold until publication | Title: | Crystal structure of anti-abTCR NANOBODY VHH | Authors: | Qiu, Y. | Deposition date: | 2024-04-12 |
|
PDBID: | 9bds | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP with Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-12 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|