| PDBID: | 8jzt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The sigF and anti-sigma factor complex | | Authors: | Chen, Y.J., Su, D. | | Deposition date: | 2023-07-06 | | Release date: | 2024-08-06 |
|
| PDBID: | 8k09 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8k08 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8tf6 | | Status: | HPUB -- hold until publication | | Title: | X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution | | Authors: | Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ? | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
(MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8tf0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-15 |
|
| PDBID: | 8tf5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8tez | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-07 | | Release date: | 2024-08-01 |
|
| PDBID: | 8tf1 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH and Pyridoxal | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-07 | | Release date: | 2024-08-01 |
|
| PDBID: | 8k0e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-08 | | Release date: | 2025-01-08 |
|
| PDBID: | 8k0f | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-08 | | Release date: | 2025-01-08 |
|
| PDBID: | 8k0g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8k0i | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8k0m | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8pq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8ppx | | Status: | HPUB -- hold until publication | | Title: | Influenza A/California/07/2009(H1N1) endonuclease in complex with flavonoid-like compound | | Authors: | Radilova, K., Brynda, J. | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8k0v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8k0w | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8k18 | | Status: | HOLD -- hold until a certain date | | Title: | Neutralization antibody ZCP4C9 bound with SARS-CoV-2 Omicron BA.5 RBD | | Authors: | Bingjie, T., Shangyu, D. | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-22 |
|
| PDBID: | 8k0y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8k19 | | Status: | HOLD -- hold until a certain date | | Title: | Neutralization antibody ZCP3B4 bound with SARS-CoV-2 Omicron BA.5 RBD | | Authors: | Tang, B., Dang, S. | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-22 |
|
| PDBID: | 8k0n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-10 | | Release date: | 2024-12-31 |
|
| PDBID: | 8k17 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8pq3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8pq6 | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pyogenes GapN in complex with NADPH and glyceraldehyde-3-phosphate | | Authors: | Wirsing, R., Schindelin, H. | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8pq8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
