| PDBID: | 9eu4 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MQQKYQPTEANLKARSEFQDNKFGIFLHWGLYAMLATGEWTMTNNNLNYKEYAKLAGGFYPSKFDADKWVAAIKASGAKYICFTTRHHEGFSMFDTKYSDYNIVKATPFKRDVVKELADACAKHGIKLHFYYSHIDWYREDAPQGRTGRRTGRPNPKGDWKSYYQFMNNQLTELLTNYGPIGAIWFDGWWDQDINPDFDWELPEQYALIHRLQPACLVGNNHHQTPFAGEDIQIFERDLPGENTAGLSGQSVSHLPLETCETMNGMWGYKITDQNYKSTKTLIHYLVKAAGKDANLLMNIGPQPDGELPEVAVQRLKEVGEWMSKYGETIYGTRGGLVAPHDWGVTTQKGNKLYVHILNLQDKALFLPIVDKKVKKAVVFADKTPVRFTKNKEGIVLELAKVPTDVDYVVELTIDDEHHHHHH
|
|
| PDBID: | 8vqh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8gha | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-09 | | Release date: | 2024-09-11 |
|
| PDBID: | 9etz | | Status: | HPUB -- hold until publication | | Title: | III2IV respiratory supercomplex from Saccharomyces cerevisiae | | Authors: | Moe, A., Brzezinski, P. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8vqi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8inc | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2023-03-09 |
|
| PDBID: | 9ev2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8ghw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-12 | | Release date: | 2024-09-12 |
|
| PDBID: | 8vqj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-18 |
|
| PDBID: | 9euv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8vgu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of BcTSPO/Hematin complex | | Authors: | Qiu, W., Guo, Y., Hendrickson, W.A. | | Deposition date: | 2023-12-28 |
|
| PDBID: | 8gig | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Methyonil-tRNA Synthetase from Rickettsia typhi in Complex with its Cognate Aminoacid | | Authors: | Penteado, R.F., Iulek, J., Seattle Structural Genomics Center for Infectious Disease (SSGCID) | | Deposition date: | 2023-03-14 |
|
| PDBID: | 9ev3 | | Status: | HPUB -- hold until publication | | Title: | Corynebacterium glutamicum pyruvate:quinone oxidoreductase (PQO) purified from bacteria grown in acetate minimal medium | | Authors: | Da Silva Lameira, C., Muenssinger, S., Yang, L., Eikmanns, B.J., Bellinzoni, M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8vh2 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CH235.12 Fab bound to the HIV-1 CH505.M5 SOSIP | | Authors: | Henderson, R., Acharya, P. | | Deposition date: | 2023-12-30 |
|
| PDBID: | 8j91 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-05-02 | | Release date: | 2024-08-07 |
|
| PDBID: | 9eut | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8vh4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-30 |
|
| PDBID: | 9ev4 | | Status: | HPUB -- hold until publication | | Title: | Pyruvate:quinone oxidoreductase (PQO) from Corynebacterium glutamicum CS176 | | Authors: | Da Silva Lameira, C., Muenssinger, S., Yang, L., Eikmanns, B.J., Bellinzoni, M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8vhz | | Status: | HPUB -- hold until publication | | Title: | Cryo EM structure of a soybean CesA1 homotrimer | | Authors: | Ho, R., Palliniti, P., Zimmer, J. | | Deposition date: | 2024-01-02 |
|
| PDBID: | 9ev5 | | Status: | HPUB -- hold until publication | | Title: | Corynebacterium glutamicum CS176 pyruvate:quinone oxidoreductase (PQO) in complex with FAD and thiamine diphosphate-magnesium ion | | Authors: | Da Silva Lameira, C., Muenssinger, S., Yang, L., Eikmanns, B.J., Bellinzoni, M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8vt6 | | Status: | HPUB -- hold until publication | | Title: | A structural study of selectivity mechanisms for JNK3 and p38 alpha with indazole scaffold probing compounds | | Authors: | Park, H., Feng, Y. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 9ev6 | | Status: | HPUB -- hold until publication | | Title: | Corynebacterium glutamicum pyruvate:quinone oxidoreductase (PQO), C-terminal truncated construct | | Authors: | Da Silva Lameira, C., Muenssinger, S., Yang, L., Eikmanns, B.J., Bellinzoni, M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8vt0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 9euw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8vt3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-25 |
|
