| PDBID: | 9bjs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bjt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bjf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bjc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bjd | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bjj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bje | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bjg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bjh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bji | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bj8 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | human CRL2-ZYG11B complex | | Authors: | Liu, X., Gross, J.D. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bj9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human CRL-2 ZYG11B binding to human NLRP1 Gly/N degron | | Authors: | Liu, X., Gross, J.D. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bjn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM of Azo-ffspy fiber | | Authors: | Zia, A., Guo, J., Xu, B., Wang, F. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bjo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM of Azo-ffsy fiber | | Authors: | Zia, A., Guo, J., Xu, B., Wang, F. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bjw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of RidA family protein PA5083 from Pseudomonas aeruginosa | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bjx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bjv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of hypothetical protein PA5083 from Pseudomonas aeruginosa Sulfur SAD phased | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9f4b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f4a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f46 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f3u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f47 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f49 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | | Authors: | Pichel, A., van Raaij, M.J. | | Deposition date: | 2024-04-26 | | Release date: | 2024-06-21 | | Sequence: | >Entity 1
KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
| PDBID: | 8zb6 | | Status: | HPUB -- hold until publication | | Title: | Yeast-expressed polio type 2 stabilized virus-like particles | | Authors: | Hong, Q., Cong, Y. | | Deposition date: | 2024-04-26 |
|
