| PDBID: | 8y73 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the Dark/Dronc complex | | Authors: | Tian, L., Li, Y., Shi, Y. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8y6w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8rwd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8rwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8vx2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8vx3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a (p)ppApp synthetase from Streptomyces albidoflavus | | Authors: | Ahmad, S., Tsang, K.K., Schiefer, V., Kim, Y., Whitney, J.C. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8vxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxb | | Status: | HOLD -- hold until a certain date | | Title: | Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin | | Authors: | Nalam, P., Cook, P., Smith, B. | | Deposition date: | 2024-02-04 | | Release date: | 2025-02-04 | | Sequence: | >Entity 1
MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
|
|
| PDBID: | 8vxg | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | The crystal structure of CYP125MRCA, an ancestrally reconstructed CYP125 enzyme | | Authors: | Doherty, D.Z., Bruning, J.B., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxi | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The crystal structure of sitosterol-bound CYP125MRCA | | Authors: | Doherty, D.Z., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7b | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a synaptic adhesion protein | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7a | | Status: | HPUB -- hold until publication | | Title: | extracellular domains of a synaptic adhesion receptor in complex with a cell adhesion molecule | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y79 | | Status: | HPUB -- hold until publication | | Title: | extracellular domain of a synaptic adhesion receptor in complex with a long peptide | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y78 | | Status: | HPUB -- hold until publication | | Title: | Extracellular domain of a synaptic adhesion molecule in complex with a short peptide | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7o | | Status: | HPUB -- hold until publication | | Title: | FluPol-NS2 complex (hexamer) | | Authors: | Peng, Q., Sun, J.Q. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7m | | Status: | HPUB -- hold until publication | | Title: | FluPol-NS2 complex (local refinement) | | Authors: | Peng, Q., Sun, J.Q. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7h | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-04 |
|
