| PDBID: | 8jvk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-28 | | Release date: | 2024-12-28 |
|
| PDBID: | 8jv9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-28 | | Release date: | 2024-12-31 |
|
| PDBID: | 8jw1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-28 | | Release date: | 2024-12-28 |
|
| PDBID: | 8jw2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-28 | | Release date: | 2024-12-28 |
|
| PDBID: | 8pns | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the acyl-CoA dehydrogenase PA0506 (FadE1) from Pseudomonas aeruginosa | | Authors: | Wang, M., Brear, P., Welch, M. | | Deposition date: | 2023-06-30 | | Release date: | 2024-12-30 |
|
| PDBID: | 8png | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the apo acyl-CoA dehydrogenase FadE2 (PA0508) from Pseudomonas aeruginosa | | Authors: | Wang, M., Brear, P., Welch, M. | | Deposition date: | 2023-06-30 | | Release date: | 2024-12-30 |
|
| PDBID: | 8pnn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 80S yeast ribosome in complex with Bromolissoclimide | | Authors: | Terrosu, S., Yusupov, M. | | Deposition date: | 2023-06-30 |
|
| PDBID: | 8pnf | | Status: | HPUB -- hold until publication | | Title: | HRV B14 virion proteins | | Authors: | Gil-Cantero, D., Mata, C.P., Mateu, M.G., Caston, J.R. | | Deposition date: | 2023-06-30 | | Release date: | 2024-12-30 |
|
| PDBID: | 8pnb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-30 | | Release date: | 2024-12-30 |
|
| PDBID: | 8jxy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | lysozyme with in situ device | | Authors: | Liang, M., Wang, Q. | | Deposition date: | 2023-07-01 | | Release date: | 2025-01-01 |
|
| PDBID: | 8jz9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8poy | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal Structure of the C120G variant of the membrane-bound [NiFe]-Hydrogenase from Cupriavidus necator in the air-oxidized state at 1.93 A Resolution. | | Authors: | Schmidt, A., Kalms, J., Scheerer, P. | | Deposition date: | 2023-07-05 |
|
| PDBID: | 8te8 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI) | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-05 | | Release date: | 2024-08-01 |
|
| PDBID: | 8jzq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-06 | | Release date: | 2025-01-06 |
|
| PDBID: | 8jzp | | Status: | HOLD -- hold until a certain date | | Title: | Structure of mouse C5a-human C5aR1-Go complex | | Authors: | Yadav, M.K., Yadav, R., Maharana, J., Sarma, P., Banerjee, R., Shukla, A.K., Gati, C. | | Deposition date: | 2023-07-06 | | Release date: | 2025-01-06 |
|
| PDBID: | 8k08 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8k09 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8tf5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8tez | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-07 | | Release date: | 2024-08-01 |
|
| PDBID: | 8tf1 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH and Pyridoxal | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-07 | | Release date: | 2024-08-01 |
|
| PDBID: | 8tf6 | | Status: | HPUB -- hold until publication | | Title: | X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution | | Authors: | Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ? | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
(MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8k0g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8pq3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8ppy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8ppx | | Status: | HPUB -- hold until publication | | Title: | Influenza A/California/07/2009(H1N1) endonuclease in complex with flavonoid-like compound | | Authors: | Radilova, K., Brynda, J. | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
