| PDBID: | 8w2b | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-20 | | Release date: | 2025-02-20 |
|
| PDBID: | 9ep0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9ep5 | | Status: | HPUB -- hold until publication | | Title: | Alpha-Galactosaminidase family GH114 from Environmental sample (99.2% identity to Myxococcus fulvus enzyme) | | Authors: | Roth, C., Moroz, O.V., Miranda, S.A.D., Jahn, L., Blagova, E., Lebedev, A.A., Segura, D.R., Stringer, M.A., Friis, E.P., Davies, G.J., Wilson, K.S. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8w27 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human tankyrase 2 SAM-PARP filament bound to compound, XAV (consensus map). | | Authors: | Malone, B.F., Zimmerman, J.L., Dow, L.E., Hite, R.K. | | Deposition date: | 2024-02-20 |
|
| PDBID: | 8hlh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Slack channel pre-open state 2 | | Authors: | Zhang, M.F. | | Deposition date: | 2022-11-30 |
|
| PDBID: | 8w2j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 8hli | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Slack channel pre-open state 1 | | Authors: | Zhang, M.F. | | Deposition date: | 2022-11-30 |
|
| PDBID: | 9ep6 | | Status: | HPUB -- hold until publication | | Title: | Alpha-Galactosaminidase family GH114 from Fusarium solani | | Authors: | Roth, C., Moroz, O.V., Miranda, S.A.D., Jahn, L., Blagova, E., Lebedev, A.A., Segura, D.R., Stringer, M.A., Friis, E.P., Davies, G.J., Wilson, K.S. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9ep9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w2i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 9epc | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of the Plastid-encoded RNA polymerase from Sinapis alba | | Authors: | Effantin, G., Blanvillain, R., Cobessi, D. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w28 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human tankyrase 2 SAM-PARP filament bound to compound, XAV (focused refinement map). | | Authors: | Malone, B.F., Zimmerman, J.L., Dow, L.E., Hite, R.K. | | Deposition date: | 2024-02-20 |
|
| PDBID: | 8w2p | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-02-20 |
|
| PDBID: | 9ep8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 in complex with a 8-(azaindolyl)-benzoazepinone inhibitor | | Authors: | Pala, D., Clark, D., Pioselli, B., Accetta, A., Rancati, F. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 8w2k | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human Tryptophan 2,3-dioxygenase in complex with PAN3F inhibitor | | Authors: | Geeraerts, Z., Yeh, S.-R. | | Deposition date: | 2024-02-20 |
|
| PDBID: | 9epj | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 41 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w31 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8w33 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9epa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w2y | | Status: | HPUB -- hold until publication | | Title: | Structure and interactions of HIV-1 gp41 CHR-NHR reverse hairpin constructs reveal molecular determinants of antiviral activity | | Authors: | McAndrew, R.P., Ralston, C.Y., Gochin, M. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8frq | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T14, long soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-01-08 | | Release date: | 2024-07-08 |
|
| PDBID: | 9epk | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9eps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
