| PDBID: | 8xhg | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xhj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-HBA complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xh8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xhi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Toxin BmKaTX15-7A | | Authors: | Gu, M.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xhe | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xhf | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xhh | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8rhy | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P34 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rhv | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P30 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rhu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P25 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rhw | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P31 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rhx | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P32 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rht | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei DHFR in complex with the cofactor and inhibitor P25 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
GSHMLSLTRILRKKIPVHELAGKISRPPLRPFSVVVASDEKGGIGDGGTIPWEIPEDMQYFRRVTTNLRGKNVKPSPSKRNAVVMGRKTWDSLPPKFRPLSNRLNVVLSRSATKEQLLAGIPDPIKRAEAANDVVAVNGGLEDALRMLVSKEHTSSIETVFCIGGGTIYKQALCAPCVNVLQAIHRTVVRPASNSCSVFFDIPAAGTKTPEGLELVRESITDERVSTGAGGKKYQFEKLVPRNS
|
|
| PDBID: | 8vdq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8vdu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8vdr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8vdp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryogenic electron microscopy model of full-length talin without FABD | | Authors: | Izard, T., Rangarajan, E.S. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xhw | | Status: | HOLD -- hold until a certain date | | Title: | Haloquadratum walsbyi middle rhodopsin mutant - D84N | | Authors: | Ko, L.N., Lim, G.Z., Yang, C.S. | | Deposition date: | 2023-12-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 8xhn | | Status: | HOLD -- hold until a certain date | | Title: | Streptococcus pneumoniae-BceAB-ADP-Peptidisc Sample. | | Authors: | He, Y., Li, J., Luo, M. | | Deposition date: | 2023-12-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 8xhq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhp | | Status: | HPUB -- hold until publication | | Title: | The apo structure of SsBcmC | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 8xht | | Status: | HPUB -- hold until publication | | Title: | The apo structure of PaBcmG | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
