| PDBID: | 8xed | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with unphosphated PhoP | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rek | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reg | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rel | | Status: | HPUB -- hold until publication | | Title: | Fab of an anti-PvAMA1 monoclonal antibody | | Authors: | Bentley, G.A., Saul, F.A., Vulliez-LeNormand, B. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reh | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rei | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a silicon HARE-chip. | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rej | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPAR gamma Ligand Binding Domain in complex with the ligand LBB78 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2023-12-11 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 8rem | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8va6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vad | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8va5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vau | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vav | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vaz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vaa | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8va4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8va3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vb0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vaj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8va7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8va9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vab | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vah | | Status: | HPUB -- hold until publication | | Title: | E.coli PNPase in complex with single 8-oxoG RNA | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vag | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vak | | Status: | HPUB -- hold until publication | | Title: | E.coli PNPase in complex with double 8-oxoG RNA | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2023-12-11 |
|
