| PDBID: | 8v32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-26 |
|
| PDBID: | 8x89 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Streptococcus pneumoniae fabG | | Authors: | Xu, K.M. | | Deposition date: | 2023-11-27 | | Sequence: | >Entity 1
MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELLAEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEADFEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGFTKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTVFLAGQDYLTGQVIAIDGGLSM
|
|
| PDBID: | 8x8e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with two PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x80 | | Status: | HPUB -- hold until publication | | Title: | Leptin-LepR trimer with a small gap | | Authors: | Xie, Y.F., Gao, F.G. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x81 | | Status: | HPUB -- hold until publication | | Title: | Leptin-LepR trimer with a large gap | | Authors: | Xie, Y.F., Gao, F.G. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription initiation complex with four GlnR and two PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of lipoxygenase from Enhygromyxa salina | | Authors: | Kim, J.W., Seo, P.W., Kim, J.S. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8h | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-27 | | Release date: | 2024-11-27 |
|
| PDBID: | 8x8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x85 | | Status: | HPUB -- hold until publication | | Title: | Leptin-LepR dimer | | Authors: | Xie, Y.F., Shang, G.J., Qi, J.X., Gao, F.G. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x86 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7r | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r82 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7x | | Status: | HPUB -- hold until publication | | Title: | Kras G12D in complex with compound 4 | | Authors: | Kessler, D., Zak, K.M. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7o | | Status: | HPUB -- hold until publication | | Title: | HUWE1 WWE domain in complex with 2''F-ATP | | Authors: | Muenzker, L., Boettcher, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7v | | Status: | HPUB -- hold until publication | | Title: | MutSbeta bound to compound CHDI-00898647 in the canonical DNA-mismatch bound form | | Authors: | Haque, T., Brace, G., Felsenfeld, D., Tilack, K., Schaertl, S., Ballantyne, G., Maillard, M., Iyer, R., Prasad, B., Thomsen, M., Wilkionson, H., Plotnikov, N., Ritzefeld, M. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
