| PDBID: | 8xf6 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of integrin ITGAV, ITGB3 and Cilengitide TFA complex, conformation 2 | | Authors: | Xi, Z. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xfb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xf8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xf9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xfa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xfh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MiCGT(E152Q/V190D/S122P) in complex with UDP | | Authors: | Zhang, Z.M., Zhou, Z.Q. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xfg | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of integrin ITGAV, ITGB3 and CYCLO (RGDFK) complex, conformation 1 | | Authors: | Xi, Z. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xfi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8xfj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure R-spondin-2 (Fu1Fu2) in complex with LGR4 and ZNRF3(RING) | | Authors: | Lu, W. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8rgv | | Status: | HPUB -- hold until publication | | Title: | Myo-inositol-1-phosphate synthase from Thermochaetoides thermophila in complex with NAD | | Authors: | Traeger, T.K., Kyrilis, F.L., Hamdi, F., Kastritis, P.L. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rgm | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of nucleosome containing Widom603 DNA | | Authors: | Motorin, N.A., Afonin, D., Armeev, G.A., Moiseenko, A., Zhao, L., Vasiliev, V., Oleinikov, P., Shaytan, A., Shi, X., Studitsky, V., Sokolova, O. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rgn | | Status: | HPUB -- hold until publication | | Title: | BmrA E504-R6G-70uMATPMg | | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rgu | | Status: | HPUB -- hold until publication | | Title: | Arginase 2 in complex with inhibitor | | Authors: | Petersen, J. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rh5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rh4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rMcL-1 in complex with galactose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vco | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rMcL-1 in complex with N-acetyl-D-galactosamine | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with raffinose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactulose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vck | | Status: | HPUB -- hold until publication | | Title: | Galactose-binding lectin from Mytilus californianus, Isoform 1 (rMcL-1) | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide | | Authors: | Ma, J., Baker, B.M. | | Deposition date: | 2023-12-14 |
|
