| PDBID: | 8wu9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human canonical nucleosome | | Authors: | Liu, X., Gong, Q.Y. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qx1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qww | | Status: | HPUB -- hold until publication | | Title: | Structure of the amyloid-forming peptide LYIQWL from Tc5b, grown from 10% ethanol without TFA | | Authors: | Durvanger, Z. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qwv | | Status: | HPUB -- hold until publication | | Title: | Structure of the amyloid-forming peptide LYIQNL, grown in the presence of ethanol | | Authors: | Durvanger, Z. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qwu | | Status: | HPUB -- hold until publication | | Title: | Structure of the amyloid-forming peptide LYIQNL, grown without ethanol | | Authors: | Durvanger, Z. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8up2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uot | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uoq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uom | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST with N-formyl-FAD in complex with H3dimeK4 histone tail | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uon | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uos | | Status: | HPUB -- hold until publication | | Title: | Designed IL1-R antagonist BB73 | | Authors: | Jude, K.M., Garcia, K.C. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8up4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8up1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8up0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uov | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wup | | Status: | HPUB -- hold until publication | | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A wild-type | | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wue | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wub | | Status: | HPUB -- hold until publication | | Title: | The X-ray structure of human neuroglobin C120S mutant | | Authors: | Lin, Y.W., Yuan, H. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wuh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of A. thaliana canonical H2A.13 nucleosome | | Authors: | Liu, X., Gong, Q.Y. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qx3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 |
|
| PDBID: | 8up5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 |
|
| PDBID: | 8wur | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SARS-Cov-2 main protease D48N mutant in complex with shikonin | | Authors: | Zhao, Z.Y., Li, W.W., Zhang, J., Li, J. | | Deposition date: | 2023-10-21 | | Release date: | 2024-10-21 |
|
| PDBID: | 8qx4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8qx6 | | Status: | HPUB -- hold until publication | | Title: | Novel laminarin-binding CBM X584 | | Authors: | Zuehlke, M.K., Jeudy, A., Czjzek, M. | | Deposition date: | 2023-10-22 | | Sequence: | >Entity 1
DFALPINFGADIEYTTGANSVPFEVVTNPEQSGINATDTKVGKVTNQGGQYEALTFLLDEAIDFSGSNKTITMKVYSEVAYQVLFKLETGMNGERANEVEVSHSGNGWEELSFNFNNARNSFVQGDDANNGQPFVPTGQYDEISIFLDFAGFTAGDFYIDDIEQN
|
|
| PDBID: | 8uph | | Status: | HPUB -- hold until publication | | Title: | Pr state of Stigmatella aurantiaca bacteriophytochrome 2 | | Authors: | Malla, T.N., Schmidt, M., Stojkovic, E.A. | | Deposition date: | 2023-10-22 |
|
