| PDBID: | 8uy8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uyb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uyq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Consensus olfactory receptor consOR4 bound to 2-methylthiazoline and in complex with mini-Gs trimeric protein | | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy6 | | Status: | HPUB -- hold until publication | | Title: | Aquaporin Z with ALFA tag and bound to nanobody | | Authors: | Stover, L., Bahramimoghaddam, H., Wang, L., Zhou, M., Laganowsky, A. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy5 | | Status: | HPUB -- hold until publication | | Title: | [ZP] Self-assembling DNA crystal with expanded genetic code using C,A,T,G, Z and P nucleotides | | Authors: | Vecchioni, S., Sha, R., Ohayon, Y.P., Hernandez, C. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uyn | | Status: | HPUB -- hold until publication | | Title: | Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular Host | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2023-11-13 | | Sequence: | >Entity 1
QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
|
|
| PDBID: | 8uy7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8x3f | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8x3k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8x3e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CYP725A4-taxadiene | | Authors: | Chang, Z. | | Deposition date: | 2023-11-13 | | Release date: | 2024-11-13 |
|
| PDBID: | 8x3x | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x41 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 2C from encephalomyocarditis virus bound with ATP | | Authors: | Zhang, H., Zhao, H., Dong, Y.H. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3l | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8r4p | | Status: | HPUB -- hold until publication | | Title: | Structure of BabA from Helicobacter pylori strain 17875 | | Authors: | Persson, K., Boren, T., Bugaytsova, J. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r4l | | Status: | HPUB -- hold until publication | | Title: | CSP1 M48L mutant without Iodide | | Authors: | Basle, A., David, S., Dennison, C. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r4m | | Status: | HPUB -- hold until publication | | Title: | CSP1 M48L mutant without Iodide | | Authors: | Basle, A., David, S., Dennison, C. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r4y | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r4r | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r4s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r4t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r4n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of neutralizing Fab Eq4.Dp46-3A from equine antivenom bound to short chain three finger alpha-neurotoxin from Dendroaspis polylepis. | | Authors: | Wibmer, C.K. | | Deposition date: | 2023-11-14 |
|
