| PDBID: | 9brp | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL047-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 | | Release date: | 2025-11-10 |
|
| PDBID: | 9fb3 | | Status: | HPUB -- hold until publication | | Title: | Human Aldose Reductase in Complex with a Covalent Ligand | | Authors: | Klee, L.-S., Heine, A., Glinca, S. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 8zh0 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with metal Iron | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 | | Release date: | 2025-11-10 | | Sequence: | >Entity 1
MGSSWSHPQFEKMSTVDTAPQSHYQETKVSEIPIVILKSSATDDVAAHEAIEALKVAGVCIVRNLLDRSTVDKVRQELQPYDKQADSFEGFPKNYCQVAGLLSKSPTYAHSIVGNKLFTAVRNYFLTSTYECWAEKGTWMSVKSPPQLDSTLALYVNPGSGDQGLHRDDATQQNWNSGASEYSLGRDSGCAMMVALTECAREDGTTRFIPGSHLWDYQYDHPSNDDPRIRYAEMRPGDAYLMLSSVIHAGSVNYSTDRRRVLAAVFAARSHLRQVENQYLTYDIETVRTFPTWLQRFMGYSLSKLFQGWVDKKDPLLVVDPNAQPEGEDDGGMKPNEGEHVVEAQI
|
|
| PDBID: | 8zh1 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 | | Release date: | 2025-11-10 |
|
| PDBID: | 8zh9 | | Status: | HPUB -- hold until publication | | Title: | The structure of ELK1-DNA complex | | Authors: | Liu, G., Sun, L.T. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of inward state Anhydromuropeptide permease (AmpG) | | Authors: | Cho, H.S., Kim, U., Chang, N., Kim, H., Yoo, Y. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh2 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate and Communesin K | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zhb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zhc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of N-terminal domain of N-methyl-D-aspartate receptor subunit NR1 in complex with patient-derived antibody | | Authors: | Nomura, N., Kumazaki, K., Amano, Y. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9bqx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9br5 | | Status: | HPUB -- hold until publication | | Title: | IL1RAP-specific Fab | | Authors: | Mallett, T.C., Williams, J.C., Park, M. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9bql | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-A-32 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-10 | | Release date: | 2025-05-10 |
|
| PDBID: | 9bqm | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-A-26 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-10 | | Release date: | 2025-05-10 |
|
| PDBID: | 9bqn | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-A-28 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-10 | | Release date: | 2025-05-10 |
|
| PDBID: | 9bqo | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor k88 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-10 | | Release date: | 2025-05-10 |
|
| PDBID: | 9bqp | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor R79 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-10 | | Release date: | 2025-05-10 |
|
| PDBID: | 9bqq | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor R81 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-10 | | Release date: | 2025-05-10 |
|
| PDBID: | 9bqt | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor R80 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-10 | | Release date: | 2025-05-10 |
|
| PDBID: | 9bqy | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor R70 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-10 | | Release date: | 2025-05-10 |
|
| PDBID: | 9bqz | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor x11 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-10 | | Release date: | 2025-05-10 |
|
| PDBID: | 9br0 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-B-84 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-10 | | Release date: | 2025-05-10 |
|
