PDBID: | 9bza | Status: | PROC -- to be processed | Title: | Class 18 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-24 |
|
PDBID: | 9c05 | Status: | AUTH -- processed, waiting for author review and approval | Title: | UIC-1+PhEt+PhiPr+o-xylene+benzene | Authors: | Heinz-Kunert, S.L. | Deposition date: | 2024-05-24 |
|
PDBID: | 9bzd | Status: | PROC -- to be processed | Title: | Class 23 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-24 |
|
PDBID: | 9c07 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-24 |
|
PDBID: | 9bzn | Status: | AUTH -- processed, waiting for author review and approval | Title: | High resolution structure of class A Beta-lactamase from Bordetella bronchiseptica RB50 | Authors: | Maltseva, N., Kim, Y., Endres, M., Joachimiak, A., Center for Structural Biology of Infectious Diseases (CSBID) | Deposition date: | 2024-05-24 |
|
PDBID: | 9byu | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-24 |
|
PDBID: | 9bzg | Status: | HPUB -- hold until publication | Title: | Targeting N-Myc in Neuroblastoma with Selective Aurora Kinase A Degraders | Authors: | Baker, Z.D., Tang, J., Shi, K., Aihara, H., Levinson, N.M., Harki, D.A. | Deposition date: | 2024-05-24 |
|
PDBID: | 9bys | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-24 |
|
PDBID: | 9bze | Status: | PROC -- to be processed | Title: | Class 26 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-24 |
|
PDBID: | 9bzs | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of cardiac amyloid fibril from a variant ATTR V30M amyloidosis patient | Authors: | Nguyen, A.B., Afrin, S., Yakubovska, A., Saelices, L. | Deposition date: | 2024-05-24 | Release date: | 2025-05-24 |
|
PDBID: | 9bzf | Status: | PROC -- to be processed | Title: | Class 28 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-24 |
|
PDBID: | 9bzh | Status: | PROC -- to be processed | Title: | Class 29 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-24 |
|
PDBID: | 9byt | Status: | PROC -- to be processed | Title: | Class 1 model for turnover condition of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-24 |
|
PDBID: | 9bzi | Status: | PROC -- to be processed | Title: | Class 31 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-24 |
|
PDBID: | 9bzj | Status: | PROC -- to be processed | Title: | Class 40 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-24 |
|
PDBID: | 9bzl | Status: | HPUB -- hold until publication | Title: | Targeting N-Myc in Neuroblastoma with Selective Aurora Kinase A Degraders | Authors: | Baker, Z.D., Tang, J., Shi, K., Aihara, H., Levinson, N.M., Harki, D.A. | Deposition date: | 2024-05-24 | Sequence: | >Entity 1 GAMESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRT(TPO)LAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNSQNKESASKQS
|
|
PDBID: | 9bzk | Status: | PROC -- to be processed | Title: | Class 43 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-24 |
|
PDBID: | 9bzm | Status: | PROC -- to be processed | Title: | Class 45 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-24 |
|
PDBID: | 9bzo | Status: | PROC -- to be processed | Title: | Class 50 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-24 |
|
PDBID: | 9c09 | Status: | HPUB -- hold until publication | Title: | Structure of K2P13.1 (THIK1) S136P in lipid nanodisc | Authors: | Roy-Chowdhury, S., Adberemane-Ali, F., Minor, D.L. | Deposition date: | 2024-05-24 |
|
PDBID: | 9c0a | Status: | AUTH -- processed, waiting for author review and approval | Title: | Effect of glutathione on the stability, dynamics and catalysis of two different classes of glutathione transferases from Taenia solium | Authors: | Miranda-Blancas, R., Sanchez-Juarez, C., Sanchez-Perez, L., Zubillaga, R., Flores-Lopez, R., Landa, A., Miranda-Blancas, R., Garcia-Gutierrez, P., Rudino-Pinera, E. | Deposition date: | 2024-05-24 |
|
PDBID: | 9bzq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Class A Beta-lactamase from Bordetella bronchiseptica RB50 in a complex with Avibactam | Authors: | Maltseva, N., Kim, Y., Endres, M., Joachimiak, A. | Deposition date: | 2024-05-24 |
|
PDBID: | 9bzr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Class A Beta-lactamase from Bordetella bronchiseptica RB50 in a complex with clavulonate | Authors: | Maltseva, N., Kim, Y., Endres, M., Joachimiak, A., Center for Structural Biology of Infectious Diseases (CSBID) | Deposition date: | 2024-05-24 |
|
PDBID: | 9c08 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of Sialyl transferase from Pasturella Multocida | Authors: | Subramanian, R., Dhanabalan, K. | Deposition date: | 2024-05-24 |
|
PDBID: | 9fgi | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-24 | Release date: | 2025-05-24 |
|