| PDBID: | 9ha9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-02 |
|
| PDBID: | 9haa | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-02 | | Release date: | 2025-11-02 |
|
| PDBID: | 9hab | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-02 | | Release date: | 2025-11-02 |
|
| PDBID: | 9kcn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of FD4-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kch | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kco | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of FD4-bound alpha-synuclein MSA-like fibril | | Authors: | Zhang, S.Q., Liu, C. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kce | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the ATP analog-bound closed state of Thermotoga maritima MutS2 | | Authors: | Fukui, K., Murakawa, T., Yano, T. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kcd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cellulose swelling protein from Talaromyces cellulolyticus | | Authors: | Watanabe, M., Kumagai, A., Nakayama, K., Nakamichi, Y., Fujii, T., Fujita, Y., Saito, Y., Inoue, H., Kanayama, N., Kato, J., Sakakibara, K., Morita, T. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kcc | | Status: | HPUB -- hold until publication | | Title: | DNA duplex containing copper-mediated 5-fluorouracil-cytosine base pairs | | Authors: | Kondo, J., Hirabayashi, K., Torigoe, H., Adachi, S. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kcf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kcp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of ACI-12589-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kci | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kcj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kck | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kcl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kcm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e7i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e7k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e7h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e77 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CSN-N8 in complex with CSN5i-3 | | Authors: | Shi, H., Zheng, N. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e7d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HIV-1 RRE SLII A31C mutant in complex with Fab BL3-6 | | Authors: | Ojha, M., Koirala, D. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e79 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the MIR domain of the S. cerevisiae mannosyltransferase Pmt4 | | Authors: | Du, M., Yuan, Z., Li, H. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e7a | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the MIR domain of the S. cerevisiae mannosyltransferase Pmt4 in Complex with Ccw5 | | Authors: | Du, M., Yuan, Z., Li, H. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e7b | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186G covalently bound to compound GRL-051-22 at 1.3 A | | Authors: | Beechboard, S.N., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-11-01 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFGDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9e7e | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HIV-1 RRE SLII A31CG39C mutant in complex with Fab BL3-6 | | Authors: | Ojha, M., Koirala, D. | | Deposition date: | 2024-11-01 |
|
