| PDBID: | 8qwa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of citrate synthase from Methylophaga sulfidovorans | | Authors: | Mais, C.-N., Bange, G., Sendker, F.L., Hochberg, G. | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of GFP variant | | Authors: | Lenz, M., Fiedler, M., Bellini, D., Chin, J.W. | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwq | | Status: | HPUB -- hold until publication | | Title: | Magic-angle spinning NMR Structure of Opa60 in Lipid Bilayers | | Authors: | Forster, M.C., Andreas, L.B. | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwu | | Status: | HPUB -- hold until publication | | Title: | Structure of the amyloid-forming peptide LYIQNL, grown without ethanol | | Authors: | Durvanger, Z. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qwv | | Status: | HPUB -- hold until publication | | Title: | Structure of the amyloid-forming peptide LYIQNL, grown in the presence of ethanol | | Authors: | Durvanger, Z. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qww | | Status: | HPUB -- hold until publication | | Title: | Structure of the amyloid-forming peptide LYIQWL from Tc5b, grown from 10% ethanol without TFA | | Authors: | Durvanger, Z. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qx1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qx3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 |
|
| PDBID: | 8qx4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8qx6 | | Status: | HPUB -- hold until publication | | Title: | Novel laminarin-binding CBM X584 | | Authors: | Zuehlke, M.K., Jeudy, A., Czjzek, M. | | Deposition date: | 2023-10-22 | | Sequence: | >Entity 1
DFALPINFGADIEYTTGANSVPFEVVTNPEQSGINATDTKVGKVTNQGGQYEALTFLLDEAIDFSGSNKTITMKVYSEVAYQVLFKLETGMNGERANEVEVSHSGNGWEELSFNFNNARNSFVQGDDANNGQPFVPTGQYDEISIFLDFAGFTAGDFYIDDIEQN
|
|
| PDBID: | 8qxc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8qxg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8qxr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-24 | | Release date: | 2024-10-24 |
|
| PDBID: | 8qxy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qxz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qy0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qy1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
