| PDBID: | 8ql4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8ql5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8ql6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8ql7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8ql8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8ql9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8qla | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8qlb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8qli | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of Paradendryphiella salina PL7C alginate lyase mutant H124 soaked with with tetra-mannuronic acid | | Authors: | Wilkens, C. | | Deposition date: | 2023-09-19 |
|
| PDBID: | 8qll | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rat glutathione transferase Omega 1 bound to glutathione | | Authors: | Schwartz, M., Neiers, F. | | Deposition date: | 2023-09-20 | | Sequence: | >Entity 1
MHHHHHHSGASARSLGKGSAPPGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEIININLKNKPEWFFEKNPFGLVPVLENTQGHLITESVITCEYLDEAYPEKKLFPDDPYEKACQKMTFELFSKVPSLVTSFIRAKRKEDHPGIKEELKKEFSKLEEAMANKRTAFFGGNSLSMIDYLIWPWFQRLEALELNECIDHTPKLKLWMATMQEDPVASSHFIDAKTYRDYLSLYLQDSPEACDYGL
|
|
| PDBID: | 8qln | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-20 |
|
| PDBID: | 8qlu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-20 |
|
| PDBID: | 8qlw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-20 |
|
| PDBID: | 8qlx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-20 |
|
| PDBID: | 8qly | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Trypanosoma brucei GMP reductase crystallized in cellulo | | Authors: | Boger, J., Redecke, L. | | Deposition date: | 2023-09-20 |
|
| PDBID: | 8qlz | | Status: | HPUB -- hold until publication | | Title: | E. coli beta-galactosidase with covalently attached 4-epi cyclophellitol | | Authors: | Alzahrani, M., Agirre, J., Blaza, J.N. | | Deposition date: | 2023-09-20 | | Sequence: | >Entity 1
MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRFAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATRFNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLRLNVENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGDTPNDRQFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHSDNELLHWMVALDGKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISAWQQWRLAENLSVTLPAASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRYHYQLVWCQK
|
|
| PDBID: | 8qm2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-21 | | Release date: | 2025-03-21 |
|
| PDBID: | 8qm4 | | Status: | HPUB -- hold until publication | | Title: | Potential drug binding sites for translation initiation factor eIF4E | | Authors: | Cleasby, A. | | Deposition date: | 2023-09-21 |
|
| PDBID: | 8qm5 | | Status: | HPUB -- hold until publication | | Title: | Potential drug binding sites for translation initiation factor eIF4E | | Authors: | Cleasby, A. | | Deposition date: | 2023-09-21 |
|
| PDBID: | 8qm6 | | Status: | HPUB -- hold until publication | | Title: | Potential drug binding sites for translation initiation factor eIF4E | | Authors: | Cleasby, A. | | Deposition date: | 2023-09-21 |
|
| PDBID: | 8qm7 | | Status: | HPUB -- hold until publication | | Title: | Potential drug binding sites for translation initiation factor eIF4E | | Authors: | Cleasby, A. | | Deposition date: | 2023-09-21 |
|
| PDBID: | 8qm8 | | Status: | HPUB -- hold until publication | | Title: | Potential drug binding sites for translation initiation factor eIF4E | | Authors: | Cleasby, A. | | Deposition date: | 2023-09-21 |
|
| PDBID: | 8qm9 | | Status: | HPUB -- hold until publication | | Title: | Potential drug binding sites for translation initiation factor eIF4E | | Authors: | Cleasby, A. | | Deposition date: | 2023-09-21 |
|
| PDBID: | 8qmb | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Nucleant-assisted 2.0 A resolution structure of the Streptococcus pneumoniae topoisomerase IV-V18mer DNA complex with the novel fluoroquinolone Delafloxacin | | Authors: | Najmudin, S., Pan, X.S., Wang, B., Cheyen, N.E., Fisher, L.M., Sanderson, M.R. | | Deposition date: | 2023-09-21 |
|
| PDBID: | 8qmc | | Status: | HOLD -- hold until a certain date | | Title: | High resolution structure of the Streptococcus pneumoniae topoisomerase IV-complex with the V-site 18mer dsDNA and novel fluoroquinolone Delafloxacin | | Authors: | Najmudin, S., Pan, X.S., Wang, B., Chayen, N.E., Fisher, L.M., Sanderson, M.R. | | Deposition date: | 2023-09-21 | | Release date: | 2024-09-21 |
|
