| PDBID: | 8x1j | | Status: | HPUB -- hold until publication | | Title: | Study on the Mechanism of Dye Decolorizing Peroxidase Degradation of PVC | | Authors: | Zhang, Z., Yanng, D. | | Deposition date: | 2023-11-08 | | Sequence: | >Entity 1
MSQVQSGILPEHCRAAIWIEANVKGDVNALREASKNFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGAEELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAAMAAFGDAIDVKEEIHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLNRMSVPDQEMMIGRTKEANEEIDGDERPVTSHLSRVDLKEDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFGDTDGKRDAMLRFTKPVTGGYYFAPSLERIQAL
>Entity 2
SQVQSGILPEHCRAAIWIEANVKGDVNALREASKNFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGAEELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAAMAAFGDAIDVKEEIHGFRPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFMLRFTKPVTGGYYFAPSLERIQAL
|
|
| PDBID: | 8x1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1r | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Taxadiene 5-alpha hydroxylase | | Authors: | Chang, Z. | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x1x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x24 | | Status: | HPUB -- hold until publication | | Title: | anti-CRISPR protein-AcrIF25 | | Authors: | Wang, J.J. | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x25 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x26 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x27 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x28 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x29 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x2b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x2c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x2d | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x2e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x2f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x2g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
