| PDBID: | 8tgw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of 1059 SOSIP trimer purified via Galanthus nivalis lectin chromatography | | Authors: | Pothula, K., Parsons, R.J., Acharya, P. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgx | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8thf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-15 |
|
| PDBID: | 8tho | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the zinc finger repeat domain of BCL11A (ZnF456) | | Authors: | Viennet, T., Yin, M., Orkin, S.H., Arthanari, H. | | Deposition date: | 2023-07-17 | | Sequence: | >Entity 1
SEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE
|
|
| PDBID: | 8thq | | Status: | HPUB -- hold until publication | | Title: | Nonamer RNA bound to hAgo2-PAZ | | Authors: | Pallan, P.S., Harp, J.M., Egli, M. | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8thw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-18 | | Release date: | 2024-11-17 |
|
| PDBID: | 8thx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-18 |
|
| PDBID: | 8thy | | Status: | HPUB -- hold until publication | | Title: | yeast actin A167E mutant rabbit-like | | Authors: | Volkmann, N., Hanein, D. | | Deposition date: | 2023-07-18 |
|
| PDBID: | 8thz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-18 |
|
| PDBID: | 8ti3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-19 |
|
| PDBID: | 8ti8 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of Shedu from Bacillus cereus | | Authors: | Gu, Y., Corbett, K. | | Deposition date: | 2023-07-19 |
|
| PDBID: | 8ti9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of octamer assembly of Shedu nuclease domain from Bacillus cereus | | Authors: | Gu, Y., Corbett, K. | | Deposition date: | 2023-07-19 |
|
| PDBID: | 8tia | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of locally-refined tetramer of Shedu nuclease domain from Bacillus cereus | | Authors: | Gu, Y., Corbett, K. | | Deposition date: | 2023-07-19 |
|
| PDBID: | 8tig | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human ACKR3 phosphorylated by GRK5 in complex with Arrestin2 | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2023-07-19 | | Release date: | 2025-01-22 |
|
| PDBID: | 8tih | | Status: | HPUB -- hold until publication | | Title: | Human ACKR3 phosphorylated by GRK2 in complex with Arrestin2 | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2023-07-19 | | Release date: | 2025-01-22 |
|
| PDBID: | 8tii | | Status: | HPUB -- hold until publication | | Title: | Human ACKR3 phosphorylated by GRK2 in complex with Arrestin2 in nanodisc | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2023-07-19 | | Release date: | 2025-01-22 |
|
| PDBID: | 8tij | | Status: | HPUB -- hold until publication | | Title: | Human ACKR3 phosphorylated by GRK5 in complex with Arrestin2 reconstructed without receptor/micelle | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2023-07-19 | | Release date: | 2025-01-22 |
|
| PDBID: | 8tik | | Status: | HPUB -- hold until publication | | Title: | Human ACKR3 phosphorylated by GRK2 in complex with Arrestin2 reconstructed without receptor/micelle | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2023-07-19 | | Release date: | 2025-01-22 |
|
| PDBID: | 8til | | Status: | HPUB -- hold until publication | | Title: | Human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 reconstructed without receptor/micelle | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2023-07-19 | | Release date: | 2025-01-22 |
|
| PDBID: | 8tin | | Status: | HPUB -- hold until publication | | Title: | Human ACKR3 phosphorylated by GRK2 in complex with Arrestin3 reconstructed without receptor/micelle | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2023-07-19 | | Release date: | 2025-01-22 |
|
| PDBID: | 8tio | | Status: | HPUB -- hold until publication | | Title: | Human ACKR3 with C tail extended by 12 glycines phosphorylated by GRK5 in complex with Arrestin2 reconstructed without receptor/micelle | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2023-07-19 | | Release date: | 2025-01-22 |
|
| PDBID: | 8tjh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-21 |
|
| PDBID: | 8tjn | | Status: | HPUB -- hold until publication | | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 1 in complex with antibody fragment 1B2: Crosslinked State 1 | | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8tjo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 1 in complex with antibody fragment 1B2: Crosslinked Intra-State 1 | | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | | Deposition date: | 2023-07-23 |
|
