| PDBID: | 8rw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 | | Sequence: | >Entity 1
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSDINSSGTTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCATEGKYGRTWYGQLEYHYWGQGTQVTVSEHHHHHH
>Entity 2
MHHHHHHESAKAVTTQKVEVKFSKAVEKLTKEDIKVTNKANNDKVLVKEVTLSEDKKSATVELYSNLAAKQTYTVDVNKVGKTEVAVGSLEAKTIEMADQTVVADEPTALQFTVKDENGTEVVSPEGIEFVTPAAEKINAKGEITLAKGTSTTVKAVYKKDGKVVAESKEVKVSAE
|
|
| PDBID: | 8rwb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rwd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8rwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8rwf | | Status: | HPUB -- hold until publication | | Title: | Domains 1 and 2 of Bacillus anthracis Sap S-layer in complex with Nb692 | | Authors: | Sogues, A., Remaut, H. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8rwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8rwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8rwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rws | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rx1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-06 |
|
| PDBID: | 8rx2 | | Status: | HPUB -- hold until publication | | Title: | Domains 1 and 2 of Sap S-layer protein from Bacillus anthracis | | Authors: | Sogues, A., Remaut, H. | | Deposition date: | 2024-02-06 |
|
| PDBID: | 8rx4 | | Status: | HPUB -- hold until publication | | Title: | Mycothione reductase from Mycobacterium xenopi in complex with co-factor FAD and redox co-factor NADP(H) | | Authors: | Oorts, L., Osipov, E.M., Beelen, S., Strelkov, S.V. | | Deposition date: | 2024-02-06 |
|
| PDBID: | 8rx5 | | Status: | HPUB -- hold until publication | | Title: | Mycothione reductase from M. tuberculosis with FAD and NADPH | | Authors: | Oorts, L., Osipov, E.M., Beelen, S., Strelkov, S.V. | | Deposition date: | 2024-02-06 |
|
| PDBID: | 8rx6 | | Status: | HPUB -- hold until publication | | Title: | Mycothione reductase from Mycobacterium tuberculosis in complex with Respiri-1093 | | Authors: | Oorts, L., Osipov, E.M., Beelen, S., Strelkov, S.V. | | Deposition date: | 2024-02-06 |
|
