| PDBID: | 8rn2 | | Status: | HPUB -- hold until publication | | Title: | Monomeric apo-influenza B polymerase, encapsidase conformation | | Authors: | Arragain, B., Cusack, S. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rn3 | | Status: | HPUB -- hold until publication | | Title: | Pseudo-symmetrical influenza B polymerase apo-dimer, encapsidase moiety (from ""Influenza B polymerase pseudo-symmetrical dimer"" | Local refinement) | | Authors: | Arragain, B., Cusack, S. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rn4 | | Status: | HPUB -- hold until publication | | Title: | Pseudo-symmetrical influenza B polymerase apo-dimer, ENDO(T) moiety (from ""Influenza B polymerase pseudo-symmetrical dimer"" | Local refinement) | | Authors: | Arragain, B., Cusack, S. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rn5 | | Status: | HPUB -- hold until publication | | Title: | Pseudo-symmetrical influenza B polymerase apo-dimer, ENDO(R) moiety (from ""Influenza B polymerase pseudo-symmetrical dimer"" | Local refinement) | | Authors: | Arragain, B., Cusack, S. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rn6 | | Status: | HPUB -- hold until publication | | Title: | Pseudo-symmetrical influenza B polymerase apo-dimer, ENDO(E) moiety (from ""Influenza B polymerase pseudo-symmetrical dimer"" | Local refinement) | | Authors: | Arragain, B., Cusack, S. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rn7 | | Status: | HPUB -- hold until publication | | Title: | Pseudo-symmetrical influenza B polymerase apo-dimer, core-only moeity (from ""Influenza B polymerase pseudo-symmetrical dimer"" | Local refinement) | | Authors: | Arragain, B., Cusack, S. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rn8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Influenza B polymerase pseudo-symmetrical apo-dimer (FluPol(E)|FluPol(S)) | | Authors: | Arragain, B., Cusack, S. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rn9 | | Status: | HPUB -- hold until publication | | Title: | Influenza B polymerase, replicase (from ""Influenza B polymerase apo-trimer"" | Local refinement) | | Authors: | Arragain, B., Cusack, S. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rna | | Status: | HPUB -- hold until publication | | Title: | Influenza B polymerase apo-trimer | | Authors: | Arragain, B., Cusack, S. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rnb | | Status: | HPUB -- hold until publication | | Title: | Influenza B polymerase, encapsidase plus 627(R) / human ANP32A (from ""Influenza B polymerase apo-trimer"" | Local refinement) | | Authors: | Arragain, B., Cusack, S. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rnc | | Status: | HPUB -- hold until publication | | Title: | Influenza B polymerase, replication complex, an asymmetric polymerase dimer bound to human ANP32A (from ""Influenza B polymerase apo-trimer"" | Local refinement) | | Authors: | Arragain, B., Cusack, S. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rne | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rnf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rni | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnj | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnk | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with myristic acid | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnl | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with lauric acid | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnm | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with testosterone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnn | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with prednisone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rno | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with isophorone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnp | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with R-limonene | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnq | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with dodecane | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnr | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with tetradecane | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rns | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase XII mimic in complex with biguanide derivative inhibitor 1-carbamimidamido-N-[(4 sulfamoylphenyl)methyl]methanimidamide | | Authors: | Baroni, C., Ferraroni, M. | | Deposition date: | 2024-01-10 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8rnz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
