PDBID: | 8ruw | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-31 |
|
PDBID: | 8ruz | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-31 |
|
PDBID: | 8rv1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-31 |
|
PDBID: | 8rv3 | Status: | HPUB -- hold until publication | Title: | Structure of the domain IV of the replication factor RctB from Vibrio cholerae | Authors: | Garcia-Pino, A., Talavera Perez, A. | Deposition date: | 2024-01-31 |
|
PDBID: | 8rvd | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-01 |
|
PDBID: | 8rvf | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF HUMAN MONOGLYCERIDE LIPASE IN COMPLEX WITH COMPOUND 5 | Authors: | Leibrock, L., Hentsch, A., Nazare, M., Grether, U., Kuhn, B., Blaising, J., Benz, J. | Deposition date: | 2024-02-01 |
|
PDBID: | 8rvg | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-01 |
|
PDBID: | 8rvh | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-01 |
|
PDBID: | 8rvi | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-01 |
|
PDBID: | 8rvr | Status: | HPUB -- hold until publication | Title: | Crystal structure of Trypanosoma congolense pyruvate kinase in complex with a single-domain antibody (TcoPYK-sdAb42) in the presence of sulfate | Authors: | Sterckx, Y.G.-J. | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvu | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvv | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 |
|
PDBID: | 8rvw | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvx | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvy | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rvz | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw0 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the adenosine A2A receptor in complex with Istradefylline | Authors: | Glover, H. | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rw9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 | Sequence: | >Entity 1 QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSDINSSGTTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCATEGKYGRTWYGQLEYHYWGQGTQVTVSEHHHHHH
>Entity 2 MHHHHHHESAKAVTTQKVEVKFSKAVEKLTKEDIKVTNKANNDKVLVKEVTLSEDKKSATVELYSNLAAKQTYTVDVNKVGKTEVAVGSLEAKTIEMADQTVVADEPTALQFTVKDENGTEVVSPEGIEFVTPAAEKINAKGEITLAKGTSTTVKAVYKKDGKVVAESKEVKVSAE
|
|
PDBID: | 8rwb | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 8rwc | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|