PDBID: | 8rrl | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-22 |
|
PDBID: | 8rrm | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-22 |
|
PDBID: | 8rrn | Status: | HPUB -- hold until publication | Title: | Crystal structure of the SARS-CoV-2 S RBD in complex with pT1616 Fab | Authors: | Hansen, G., Krey, T. | Deposition date: | 2024-01-23 |
|
PDBID: | 8rro | Status: | HPUB -- hold until publication | Title: | G12V-TCR complex with HLA-A3 | Authors: | Sim, M.J.W., Sun, P.D. | Deposition date: | 2024-01-23 |
|
PDBID: | 8rs1 | Status: | HPUB -- hold until publication | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (125 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rs2 | Status: | HPUB -- hold until publication | Title: | Thaumatin measured via serial crystallography from a silicon HARE-chip. | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sihyun, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rs3 | Status: | HPUB -- hold until publication | Title: | Thaumatin measured via serial crystallography from a kapton HARE-chip (50 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rs4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-24 |
|
PDBID: | 8rs6 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-24 |
|
PDBID: | 8rs7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Zika Virus NS2B-NS3 protease in complex with an allosteric inhibitor | Authors: | Ontario, J.M., Torrente, E. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rs8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-24 |
|
PDBID: | 8rsd | Status: | AUTH -- processed, waiting for author review and approval | Title: | Thaumatin measured via serial crystallography from a kapton HARE-chip (125 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rse | Status: | HPUB -- hold until publication | Title: | Proteinase K measured via serial crystallography from a silicon HARE-chip | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rsf | Status: | HPUB -- hold until publication | Title: | Proteinase K measured via serial crystallography from a kapton HARE-chip (50 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rsg | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-24 |
|
PDBID: | 8rsh | Status: | HPUB -- hold until publication | Title: | Lysozyme measured via serial crystallography from a silicon HARE chip | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rso | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8rsp | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8rsq | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8rsr | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8rss | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 | Sequence: | >Entity 1 MEELTYRLFMVATVGMLAGTVFLLASSREVKPEHRRGVYISALVCGIAWYHYQKMGASWESGSYDTGLRYVDWVLTVPLMFVEVLAVTRKGAAYNEAVRNWGIAATVMIGAGYYGETSAAGSNEYWTGFVIAMATYVWLMRNLQAEGEGLKGDQAVAFENIKNLILVGWIIYPLGYIAPVVGDFDAIREVLYTIADIIN(LYR)VGLGVLVLQMARVQSGEKVS
|
|
PDBID: | 8rsw | Status: | HOLD -- hold until a certain date | Title: | Solution NMR structure of Pacsin 2 SH3 domain | Authors: | Tossavainen, H., Permi, P. | Deposition date: | 2024-01-25 | Release date: | 2024-02-22 |
|
PDBID: | 8rsx | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8rsy | Status: | HPUB -- hold until publication | Title: | TRYPTOPHAN SYNTHASE measured via serial crystallography from a kapton HARE-chip (50 micron) | Authors: | Sung, S., Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., von Stetten, D., Mehrabi, P., Wilmanns, M., Schulz, E.C. | Deposition date: | 2024-01-25 |
|
PDBID: | 8rsz | Status: | HPUB -- hold until publication | Title: | TRYPTOPHAN SYNTHASE measured via serial crystallography from a kapton HARE-chip (125 micron) | Authors: | Sung, S., Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., von Stetten, D., Mehrabi, P., Schulz, E.C., Wilmanns, M. | Deposition date: | 2024-01-25 |
|