| PDBID: | 8qz7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qza | | Status: | HPUB -- hold until publication | | Title: | D-2-hydroxyacid dehydrogenase (D2-HDH) from Haloferax mediterranei apo-enzyme (2.25 A resolution) | | Authors: | Baker, P.J., Barrett, J.R., Dakhil, A.A.A.B., Domenech, J., Bisson, C., Pramanpol, N., Sedelnikova, S.E., Ferrer, J., Rice, D.W. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qzb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qzl | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM co-structure of Klebsiella pneumoniae AcrB with the BDM91288 efflux pump inhibitor at 3.42 Angstrom resolution | | Authors: | Boernsen, C., Mueller, R.T., Pos, K.M., Frangakis, A.S. | | Deposition date: | 2023-10-27 |
|
| PDBID: | 8qzm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-27 |
|
| PDBID: | 8qzq | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM co-structure of E. coli AcrB with bound BDM91531 inhibitor | | Authors: | Boernsen, C., Mueller, R.T., Pos, K.M., Frangakis, A.S. | | Deposition date: | 2023-10-29 |
|
| PDBID: | 8qzt | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM co-structure of E. coli AcrB with bound BDM91531 inhibitor at 3.52 A resolution | | Authors: | Boernsen, C., Mueller, R.T., Pos, K.M., Frangakis, A.S. | | Deposition date: | 2023-10-29 |
|
| PDBID: | 8qzu | | Status: | HPUB -- hold until publication | | Title: | XhpG hydrolase mutant S98A of Xenorhabdus hominickii | | Authors: | Calderari, A., Gruez, A., Weissman, K.J. | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8qzy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8r00 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human PXR ligand-binding domain in complex with furanodienone | | Authors: | Bourguet, W., Carivenc, C., Sirounian, S. | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8r01 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-30 | | Release date: | 2024-10-30 |
|
| PDBID: | 8r0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Borneoldehydrogenase ancestor N39 | | Authors: | Helmer, C.P.O., Dimos, N., Loll, B. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0h | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with (E)-3-(2-(thiophen-2-yl)vinyl)-3,4-dihydroquinoxalin-2(1H)-one and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0q | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 6-bromo-1H-benzo[d]imidazol-2-amine and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-31 | | Release date: | 2024-10-31 |
|
| PDBID: | 8r0w | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 5-bromobenzo[d]oxazol-2-amine and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-11-01 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0y | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 3-((3-hydroxyphenyl)amino)quinoxaline-2-carboxylic acid and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-11-01 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
