| PDBID: | 8pxe | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the N-terminal dimerisation domain of Hh1141 | | Authors: | Wilk, P., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MASFEDTLKATIKSNTKQDIKILKIQNLQSSPDVKLVLIAVGNMQVPIFASKDGKLVMGVSNVFFAHKSEDMGAVGSLIKQTQSESKPDKAILDTLFKKIPQDEYIILRSPNKNAKKITYIVSDPNCPSCQKELNNIQERLKDSDVYMLLVGFVGEDSPIKSSMLRDRLLDVKDDKEKLKILREVYTPKSKVPTSYINIDIKDTMKINQKVIDAGIKSVPFVYERNKLEHHHHHHH
|
|
| PDBID: | 8pxf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the full length Hh1412 Dsb homodimer. | | Authors: | Wilk, P., Orlikowska, M., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MDKAELQKTLQANKIQGNIVSSSDLGSGLSMVIVEVNNQQAPFLATDDGKMIFQAEVLIAQDKSTESRVQEFYKNLYEKEKLRISAKLKEVFKAQKANVFTFKAKKPSNKTIYIVSDFNCPYCQREFANLDKRLESANVELLVVGFLGEDSILKAANALKNKSGNQAKDIAMLQKLYTPKSKGQSMDIKAAMALTQAVADTGVRSVPYIIEPHHHHHH
|
|
| PDBID: | 8pxi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8pxo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-23 | | Release date: | 2025-01-23 |
|
| PDBID: | 8pxp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Compound II structure of Y389F variant of A type dye-decolourising peroxidase DtpAa | | Authors: | Lucic, M., Thompson, A., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2023-07-24 |
|
| PDBID: | 8pxq | | Status: | HPUB -- hold until publication | | Title: | SFX Ferric structure of Y389F variant of A type dye-decolourising peroxidase DtpAa | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Pfalzgraf, H. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 8pxy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-24 |
|
| PDBID: | 8pxz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-24 |
|
| PDBID: | 8py0 | | Status: | HPUB -- hold until publication | | Title: | Sensor domain of Oscillibacter ruminantium chemoreceptor in complex with formate. | | Authors: | Gavira, J.A., Krell, T., Monteagudo-Cascales, E., Velando, F., Matilla, M.A., Martinez-Rodriguez, S. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 8py1 | | Status: | HPUB -- hold until publication | | Title: | Sensor domain of Asticcacaulis benevestitus chemoreceptor in complex with formate. | | Authors: | Gavira, J.A., Krell, T., Monteagudo-Cascales, E., Velando, F., Matilla, M.A., Martinez-Rodriguez, S. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 8py2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human BRISC dimer complex bound to compound JMS-175-2 | | Authors: | Chandler, F., Zeqiraj, E. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 8py4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-25 | | Release date: | 2025-01-25 |
|
| PDBID: | 8py5 | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and ACdV under anaerobic conditions | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2023-07-25 |
|
| PDBID: | 8py6 | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and ACdV under anaerobic conditions | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2023-07-25 |
|
| PDBID: | 8py7 | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe, ACdV and O2 after 1s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2023-07-25 |
|
| PDBID: | 8py8 | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe, ACdV and O2 after 2s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2023-07-25 |
|
| PDBID: | 8py9 | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe, O2, ACdV or thioaldehyde after 3s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2023-07-25 |
|
| PDBID: | 8pya | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe, O2, ACdV or thioaldehyde after 4s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2023-07-25 |
|
| PDBID: | 8pyt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-26 | | Release date: | 2025-01-26 |
|
| PDBID: | 8pyu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-26 | | Release date: | 2025-01-26 |
|
| PDBID: | 8pz1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-26 |
|
| PDBID: | 8pz2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-26 |
|
| PDBID: | 8pzg | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Metagenomic lipase ORF17 | | Authors: | Rangel Pereira, M., Balan, A., Hyvonen, M. | | Deposition date: | 2023-07-27 |
|
| PDBID: | 8pzu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-27 |
|
| PDBID: | 8pzv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-27 |
|
