| PDBID: | 9bzh | | Status: | HPUB -- hold until publication | | Title: | Class 29 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzi | | Status: | HPUB -- hold until publication | | Title: | Class 31 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzj | | Status: | HPUB -- hold until publication | | Title: | Class 40 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzk | | Status: | HPUB -- hold until publication | | Title: | Class 43 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzl | | Status: | HPUB -- hold until publication | | Title: | Targeting N-Myc in Neuroblastoma with Selective Aurora Kinase A Degraders | | Authors: | Baker, Z.D., Tang, J., Shi, K., Aihara, H., Levinson, N.M., Harki, D.A. | | Deposition date: | 2024-05-24 | | Sequence: | >Entity 1
GAMESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRT(TPO)LAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNSQNKESASKQS
|
|
| PDBID: | 9bzm | | Status: | HPUB -- hold until publication | | Title: | Class 45 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzo | | Status: | HPUB -- hold until publication | | Title: | Class 50 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzs | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cardiac amyloid fibril from a variant ATTR V30M amyloidosis patient | | Authors: | Nguyen, A.B., Afrin, S., Yakubovska, A., Saelices, L. | | Deposition date: | 2024-05-24 | | Release date: | 2025-05-24 |
|
| PDBID: | 9bzt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzu | | Status: | HPUB -- hold until publication | | Title: | UIC-1 peptide with toluene bound | | Authors: | Heinz-Kunert, S.L. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzv | | Status: | HPUB -- hold until publication | | Title: | UIC-1_isopropylbenzene | | Authors: | Heinz-Kunert, S.L. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzw | | Status: | HPUB -- hold until publication | | Title: | UIC-1 peptide soaked in p-xylene | | Authors: | Heinz-Kunert, S.L. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzx | | Status: | HPUB -- hold until publication | | Title: | UIC-1 peptide bound with o-xylene | | Authors: | Heinz-Kunert, S.L. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzy | | Status: | HPUB -- hold until publication | | Title: | UIC-1 peptide bound with m-xylene | | Authors: | Heinz-Kunert, S.L. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzz | | Status: | HPUB -- hold until publication | | Title: | UIC-1 peptide bound with ethylbenzene | | Authors: | Heinz-Kunert, S.L. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9c00 | | Status: | HPUB -- hold until publication | | Title: | UIC-1_chloroethanebenzene | | Authors: | Heinz-Kunert, S.L. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9c01 | | Status: | HPUB -- hold until publication | | Title: | UIC-1 bound to phenol | | Authors: | Heinz-Kunert, S.L. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9c02 | | Status: | HPUB -- hold until publication | | Title: | UIC-1-B7M_xylene_mix | | Authors: | Heinz-Kunert, S.L. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9c03 | | Status: | HPUB -- hold until publication | | Title: | UIC-1-A4S/B7M bound with xylenes | | Authors: | Heinz-Kunert, S.L. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9c04 | | Status: | HPUB -- hold until publication | | Title: | UIC-1_p-xylene+ethylbenzene+toluene | | Authors: | Heinz-Kunert, S.L. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9c05 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | UIC-1+PhEt+PhiPr+o-xylene+benzene | | Authors: | Heinz-Kunert, S.L. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9c06 | | Status: | HPUB -- hold until publication | | Title: | UIC-1-A4S/B5F(4-Cl)/B7M+ xylenes | | Authors: | Heinz-Kunert, S.L., Nguyen, A.I. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9c07 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9c08 | | Status: | HPUB -- hold until publication | | Title: | Structure of Sialyl transferase from Pasturella Multocida | | Authors: | Subramanian, R., Dhanabalan, K. | | Deposition date: | 2024-05-24 | | Sequence: | >Entity 1
MDKFAEHEIPKAVIVAGNGESLSQIDYRLLPKNYDVFRCNQFYFEERYFLGNKIKAVFFTPGVFLEQYYTLYHLKRNNEYFVDNVILSSFNHPTVDLEKSQKIQALFIDVINGYEKHLSKLTAFDVYLRYKELYENQRITSGVYMCAVAIAMGYTDIYLTGIDFYQASEENYAFDNKKPNIIRLLPDFRKEKTLFSYHSKDIDLEALSFLQQHYHVNFYSISPMSPLSKHFPIPTVEDDCETTFVAPLKENYINDILLPPHFVYEKLGTIVSKKSRFHSNLIVRLIRDLLKLPSALKHYLKEK
|
|
