| PDBID: | 8vbx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vc0 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 CA crosslinked pentamer in complex with GS-CA1 | | Authors: | Piacentini, J., Ganser-Pornillos, B.K., Pornillos, O. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8vc7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8vc9 | | Status: | HPUB -- hold until publication | | Title: | Hybrid response regulator LvrB from Leptospira / phosphorylated REC form | | Authors: | Mechaly, A., Buschiazzo, A. | | Deposition date: | 2023-12-13 | | Sequence: | >Entity 1
MNKWKFLFLEDSLVDLELIQRQLNRAKIDYYPIHVSDSEGFSQAILDQKPHLILSDFSLPKYDGFSALKLAKKICPTTPFIFVSGTYGEEAAIQTLTMGATDYVLKDRIEKLLPAVQRALHELEDHELRIKAEKERYELEEQLRQSQKLEAMGVMAGTMAHEINNPLIAISEYAAMIAKGEVDSEKAKQLASKIRDESARISTIMKNLLRFSRDDKGSLYPVEVGEILVKLESITQQIFKMNRIDASWKNVEPGHSIQCREGQILQILLNLVNNAVDSLNQKYPEYDTEKRIILENSIVEENHKKYAEFSIQDFGTGIPIDIQKSIFKTFFTTKSADKGTGLGLSVSLGIAKEHGGSLNFESEPGRYTRFYLRVPIFDPSVQ
|
|
| PDBID: | 8vcb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8vcf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vck | | Status: | HPUB -- hold until publication | | Title: | Galactose-binding lectin from Mytilus californianus, Isoform 1 (rMcL-1) | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide | | Authors: | Ma, J., Baker, B.M. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rMcL-1 in complex with galactose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vco | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rMcL-1 in complex with N-acetyl-D-galactosamine | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dimeric rMcL-1 in complex with raffinose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with raffinose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactulose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody (GPC-C epitope) | | Authors: | Brouwer, P.J.M., Perrett, H.R., Ward, A.B. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vd6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vdf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human monoclonal antibody C7 targeting IT4VAR22 CIDRa1.7 (PfEMP1 A) | | Authors: | Raghavan, S.S.R., Ward, A.B. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vdg | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human monoclonal antibody C74 targeting IT4VAR22 CIDRa1.7 | | Authors: | Raghavan, S.S.R., Ward, A.B. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vdh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vdi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vdj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vdl | | Status: | HPUB -- hold until publication | | Title: | HB3VAR03 CIDRa1.4 domain with C7 Fab | | Authors: | Hurlburt, N.K., Pancera, M. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vdo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-16 |
|
| PDBID: | 8vdp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryogenic electron microscopy model of full-length talin without FABD | | Authors: | Izard, T., Rangarajan, E.S. | | Deposition date: | 2023-12-17 |
|
