| PDBID: | 8t3z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-08 | | Release date: | 2024-12-04 |
|
| PDBID: | 8t54 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-12 | | Release date: | 2024-12-04 |
|
| PDBID: | 8t5o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-14 | | Release date: | 2024-11-20 |
|
| PDBID: | 8t68 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal Structure of the SET Domain of Human Histone-Lysine N-Methyltransferase SUV420H1 in complex with RQ3-111 | | Authors: | Zeng, H., Dong, A., Brown, P.J., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-06-15 |
|
| PDBID: | 8t6m | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-06-16 | | Release date: | 2024-12-21 |
|
| PDBID: | 8t7r | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human leukocyte antigen A*0101 in complex with the Fab of alloreactive antibody E07 | | Authors: | Green, T.J., Killian Jr, J.T., Qiu, S., Macon, K.J., Yang, G., King, R.G., Lund, F.E. | | Deposition date: | 2023-06-21 | | Release date: | 2024-12-21 |
|
| PDBID: | 8t8j | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-06-22 | | Release date: | 2024-12-18 |
|
| PDBID: | 8t9g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-23 | | Release date: | 2024-12-18 |
|
| PDBID: | 8t9s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-24 |
|
| PDBID: | 8tas | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-27 | | Release date: | 2024-12-18 |
|
| PDBID: | 8tb9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-28 | | Release date: | 2024-12-18 |
|
| PDBID: | 8tbc | | Status: | HPUB -- hold until publication | | Title: | Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg | | Authors: | Abhiraman, G.C., Jude, K.M., Garcia, K.C. | | Deposition date: | 2023-06-28 | | Release date: | 2024-12-28 |
|
| PDBID: | 8tcb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-30 | | Release date: | 2024-12-30 |
|
| PDBID: | 8te8 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI) | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-05 | | Release date: | 2024-08-01 |
|
| PDBID: | 8tez | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-07 | | Release date: | 2024-08-01 |
|
| PDBID: | 8tf0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-15 |
|
| PDBID: | 8tf1 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH and Pyridoxal | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-07 | | Release date: | 2024-08-01 |
|
| PDBID: | 8tf5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8tf6 | | Status: | HPUB -- hold until publication | | Title: | X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution | | Authors: | Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ? | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
(MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8tfd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-08 |
|
| PDBID: | 8tg0 | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of the cold shock domain of the Arabidopsis thaliana glycine-rich protein AtGRP2 | | Authors: | Pougy, K.C., Almeida, F.C.L., Pinheiro, A.S. | | Deposition date: | 2023-07-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 8tg2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of the post-reactive state of UDP-sugar pyrophosphorylase from Leishmania major in complex with products UDP-Glucose and PPi | | Authors: | Prakash, O., Fuehring, J.I., Baruch, P., Routier, F.H., Fedorov, R. | | Deposition date: | 2023-07-12 | | Release date: | 2025-01-25 |
|
| PDBID: | 8tgs | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of the post-reactive state of UDP-sugar pyrophosphorylase from Leishmania major in complex with product UDP-Glucose and by-product analog VO4 (orthovanadate) | | Authors: | Prakash, O., Fuehring, J.I., Baruch, P., Routier, F.H., Fedorov, R. | | Deposition date: | 2023-07-13 | | Release date: | 2025-01-13 |
|
| PDBID: | 8tgx | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8thq | | Status: | HPUB -- hold until publication | | Title: | Nonamer RNA bound to hAgo2-PAZ | | Authors: | Pallan, P.S., Harp, J.M., Egli, M. | | Deposition date: | 2023-07-17 | | Release date: | 2024-12-15 |
|
