| PDBID: | 8rlv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-03 |
|
| PDBID: | 8rlw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rlx | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase T188A mutant | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rly | | Status: | HPUB -- hold until publication | | Title: | E. coli endonuclease IV complexed with sulfate, catalytic Fe2+ | | Authors: | Saper, M.A., Paterson, N.G., Kirillov, S., Rouvinski, A. | | Deposition date: | 2024-01-04 | | Sequence: | >Entity 1
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQTEKAVA
|
|
| PDBID: | 8rlz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rm0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rm1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rm2 | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase T188E mutant | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rm3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ferrioxamine transporter FoxA | | Authors: | Josts, I., Tidow, H., Mislin, G. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8rm4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rm8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-05 | | Release date: | 2025-01-05 |
|
| PDBID: | 8rm9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-05 | | Release date: | 2025-01-05 |
|
| PDBID: | 8rma | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmb | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase (R65S+T188D) double mutant | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmc | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rme | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of parallel G-quadruplex containing T-tetrads and TG-octaplet | | Authors: | Abdullrahman, A., El Omari, K., Paterson, N., Orr, C., Lambert, M., Cardin, C.J., Sanchez-Weatherby, J., Hall, J.P. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8rmi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ferrioxamine transporter FoxA | | Authors: | Josts, I., Tidow, H., Mislin, G. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8rmj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8rmp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8rmq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8rmr | | Status: | HPUB -- hold until publication | | Title: | Influenza polymerase A/H7N9-4M replication complex, an asymmetric polymerase dimer bound to human ANP32A | | Authors: | Arragain, B., Cusack, S. | | Deposition date: | 2024-01-08 |
|
