PDBID: | 8w7j | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of ClassIII Lanthipeptide modification enzyme PneKC with chain A bounded to substrate PneA and GTP. | Authors: | Li, Y., Luo, M., Shao, K., Li, J., Li, Z. | Deposition date: | 2023-08-30 |
|
PDBID: | 8w7k | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-30 |
|
PDBID: | 8w7l | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of ClassIII Lanthipeptide modification enzyme PneKC mutant H522A. | Authors: | Li, Y., Luo, M., Shao, K., Li, J., Li, Z. | Deposition date: | 2023-08-30 |
|
PDBID: | 8w7r | Status: | HOLD -- hold until a certain date | Title: | H. walsbyi bacteriorhodopsin mutant - W94F | Authors: | Li, G.Y., Chen, J.C., Yang, C.S. | Deposition date: | 2023-08-31 | Release date: | 2024-08-31 |
|
PDBID: | 8w7w | Status: | HPUB -- hold until publication | Title: | Crystal structure of d(CGTATACG)2 with acridine complex | Authors: | Huang, S.C., Satange, R.B., Hou, M.H. | Deposition date: | 2023-08-31 |
|
PDBID: | 8w7x | Status: | HPUB -- hold until publication | Title: | SPS_Carbonic Anhydrases | Authors: | Chun, I.S., Kim, M.S. | Deposition date: | 2023-08-31 |
|
PDBID: | 8w7y | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of GcCGT in complex with UDP | Authors: | Zhang, M., Bao, Y. | Deposition date: | 2023-08-31 | Release date: | 2024-08-31 |
|
PDBID: | 8w7z | Status: | HPUB -- hold until publication | Title: | Apo form structure of pyrrolysyl-tRNA synthetase from methanogenic archaeon ISO4-G1 | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | Deposition date: | 2023-08-31 |
|
PDBID: | 8w82 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|
PDBID: | 8w8g | Status: | HPUB -- hold until publication | Title: | Crystal structure of human TRF1 with PinX1 | Authors: | Lei, M., Wu, J. | Deposition date: | 2023-09-02 |
|
PDBID: | 8w8h | Status: | HPUB -- hold until publication | Title: | 2-Ketoglutarate-Dependent Dioxygenase | Authors: | Zheng, C.N., Wei, W.Q. | Deposition date: | 2023-09-02 |
|
PDBID: | 8w8i | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-02 | Sequence: | >Entity 1 MKKLLIAAGSVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIALHHHHHH
>Entity 2 MKKLLIAAGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMYWVRQAPGKGLEWVSKINTNGLITKYPDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCARSPSGFNRGQGTLVTVSSHHHHHH
|
|
PDBID: | 8w8j | Status: | HPUB -- hold until publication | Title: | Crystal structure of bacterial prolyl-tRNA synthetase in complex with inhibitor PAA-19 | Authors: | Luo, Z., Zhou, H. | Deposition date: | 2023-09-03 |
|
PDBID: | 8w8l | Status: | HPUB -- hold until publication | Title: | Crystal structure of bacterial prolyl-tRNA synthetase in complex with inhibitor PAA-38 | Authors: | Luo, Z., Zhou, H. | Deposition date: | 2023-09-03 |
|
PDBID: | 8w8m | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8n | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8o | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8p | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8u | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8v | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8w | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of alpha-MSH-MC3R-Gs_Nb35 complex | Authors: | Chen, Q., Fu, J. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8x | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of beta-MSH-MC3R-Gs_Nb35 complex | Authors: | Chen, Q., Fu, J. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8y | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of gamma-MSH-MC3R-Gs_Nb35 complex | Authors: | Chen, Q., Fu, J. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8z | Status: | HPUB -- hold until publication | Title: | Escherichia coli ferritin mutant-M52H | Authors: | Zhao, G., Zeng, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w90 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-09-04 | Release date: | 2024-09-04 |
|