| PDBID: | 9ipo | | Status: | HPUB -- hold until publication | | Title: | Hemichannel-focused structure of BRIL-fused connexin36/Cx36/GJD2 gap junction intercellular channel in soybean polar lipid nanodiscs, treated by carbenoxolone with 10-fold molar excess (FN conformation) | | Authors: | Jang, H.S. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Hemichannel-focused structure of BRIL-fused connexin36/Cx36/GJD2 gap junction intercellular channel in soybean polar lipid nanodiscs, treated by carbenoxolone with 20-fold molar excess (FN conformation) | | Authors: | Jang, H.S. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | cryo-EM structure of the RNF168(1-193)/UbcH5c-Ub ubiquitylation module bound to H1.0-K63-Ub3 modified chromatosome | | Authors: | Ai, H.S., Deng, Z.H., Liu, L. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of VHL-EloB-EloC in complex with a fragment compound 7HC_5(D3) | | Authors: | Lee, B.I., Kim, Y. | | Deposition date: | 2024-07-11 | | Release date: | 2025-01-11 |
|
| PDBID: | 9clj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HIV-2 CA T=1 Icosahedron; assembled via lipid templating | | Authors: | Cook, M., Freniere, C., Xiong, Y. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9cli | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure-derived insights from blood factors binding to surfaces of different adenoviruses | | Authors: | Reddy, V.S. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9clf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9clg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9clh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray diffraction structure of the apo form of papain | | Authors: | Vlahakis, N.W., Rodriguez, J.A. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9clo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | DosP R97A with c-di-GMP | | Authors: | Kumar, P., Kober, D.L. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9cln | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure-derived insights from blood factors binding to surfaces of different adenoviruses | | Authors: | Reddy, V.S. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9clm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Transferrin Binding Protein A in complex with transferrin binding protein B and two molecules of transferrin | | Authors: | Dubey, S., Noinaj, N. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9g1w | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g23 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
| PDBID: | 9g24 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
| PDBID: | 9g1x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
| PDBID: | 9g1i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g2f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
| PDBID: | 9g2b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g2c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
