| PDBID: | 9qqf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the WIM8E5 Fab - HLA-A*11:01 human alloantibody-HLA complex | | Authors: | Zampieri, V., Priddey, A., Humm, A.S., Pellegrini, E., Heidt, S., Kosmoliaptsis, V., Marquez, J.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qpy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 as isolated form at 1.07-A resolution | | Authors: | Wissink, M., Wagner, T. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq5 | | Status: | HPUB -- hold until publication | | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 in a partially oxidized state | | Authors: | Wissink, M., Wagner, T. | | Deposition date: | 2025-03-31 | | Sequence: | >Entity 1
MSQKIIDALNKDREEELSAIIQYMKHHYEGEGMESPAILEIFKSIAKSEMDHAEKLGERIVYLGGTPTKKPEPIAEGGDLKKMVQDDLAKENHAIEQYKEHIKLAIEEDDPTTRLMLEEILSDEEDHADTWQTLLKVKK
|
|
| PDBID: | 9qqh | | Status: | HPUB -- hold until publication | | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 oxidized then chemically reduced | | Authors: | Wissink, M., Wagner, T. | | Deposition date: | 2025-03-31 | | Sequence: | >Entity 1
MSQKIIDALNKDREEELSAIIQYMKHHYEGEGMESPAILEIFKSIAKSEMDHAEKLGERIVYLGGTPTKKPEPIAEGGDLKKMVQDDLAKENHAIEQYKEHIKLAIEEDDPTTRLMLEEILSDEEDHADTWQTLLKVKK
|
|
| PDBID: | 9qqc | | Status: | HPUB -- hold until publication | | Title: | Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic ON | | Authors: | Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq1 | | Status: | HPUB -- hold until publication | | Title: | KRAS-G12D(1-169) - GDP IN covalent COMPLEX with compound (3S,4R)-8 | | Authors: | Ostermann, N. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqg | | Status: | HPUB -- hold until publication | | Title: | Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic OFF | | Authors: | Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9u9w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IphC close conformation | | Authors: | Garg, H., Mahto, J.K., Kumar, P. | | Deposition date: | 2025-03-30 |
|
| PDBID: | 9u9x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-30 |
|
| PDBID: | 9u9y | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-30 |
|
| PDBID: | 9u9z | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-30 |
|
| PDBID: | 9nyz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-30 |
|
| PDBID: | 9qpx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-30 |
|
| PDBID: | 9u9o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phtE open conformation | | Authors: | Mahto, J.K., Kumar, P. | | Deposition date: | 2025-03-29 |
|
| PDBID: | 9u9p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phtE close conformation | | Authors: | Mahto, J.K., Kumar, P. | | Deposition date: | 2025-03-29 |
|
| PDBID: | 9u9r | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-29 |
|
| PDBID: | 9u9s | | Status: | HPUB -- hold until publication | | Title: | ARF1(Q71L) bound M4-CTD-docked AP-4 core | | Authors: | Wang, Y.H., Li, W. | | Deposition date: | 2025-03-29 |
|
| PDBID: | 9u9v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-29 |
|
| PDBID: | 9u9u | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - Lys181Met/Trp185Tyr/His280Ala with (S)-2-fluoro-3-(4-(trifluoromethyl)phenyl)propanoic acid | | Authors: | Huang, H.S., Zhang, Z.M. | | Deposition date: | 2025-03-29 |
|
| PDBID: | 9u9q | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-03-29 | | Release date: | 2026-03-29 |
|
| PDBID: | 9u9t | | Status: | HPUB -- hold until publication | | Title: | Serine Beta-Lactamase OXA-48 in complex with Dual MBL/SBL inhibitor FB1-9 | | Authors: | Li, G.-B., Liang, G.-Q. | | Deposition date: | 2025-03-29 |
|
| PDBID: | 9nyx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-29 |
|
| PDBID: | 9qpw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-29 |
|
| PDBID: | 9qpu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-29 |
|
