| PDBID: | 9udx | | Status: | HPUB -- hold until publication | | Title: | apo SLC37A2 in a symmetric outward-facing state by adding G6P | | Authors: | Sun, L., Liu, X., Lai, Q. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9ue1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9uds | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udl | | Status: | HPUB -- hold until publication | | Title: | Cocrystal structure of human cytosolic phenylalanyl-tRNA synthetase and an inhibitor | | Authors: | Qiao, H., Hei, Z., Fang, P. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3y | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGAIGTVMTFL
|
|
| PDBID: | 9o3t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISAIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9o3s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADAVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9o3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o39 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the E. coli HtpG N-terminal and middle domain dimer in complex with AMPPNP | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3c | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a fully closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3a | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a semi-closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3m | | Status: | HPUB -- hold until publication | | Title: | K40F mutant of hCRBPII bound to fentanyl | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTFVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
|
|
| PDBID: | 9o3d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of broadly neutralizing antibody HEPC108 in complex with Hepatitis C virus envelope glycoprotein E2 ectodomain | | Authors: | Flyak, A.I., Wilcox, X.E. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3g | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3w | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
