PDBID: | 9iay | Status: | HPUB -- hold until publication | Title: | Structure of 10 in complex with GDP-KRAS | Authors: | Boettcher, J. | Deposition date: | 2025-02-11 |
|
PDBID: | 9ib4 | Status: | HPUB -- hold until publication | Title: | Structure of 12 in complex with GDP-KRAS | Authors: | Boettcher, J. | Deposition date: | 2025-02-11 |
|
PDBID: | 9ib5 | Status: | HPUB -- hold until publication | Title: | Structure of 18 (BI-2493) in complex with GDP-KRAS | Authors: | Boettcher, J. | Deposition date: | 2025-02-11 |
|
PDBID: | 9n9t | Status: | HPUB -- hold until publication | Title: | Crystal structure of Main protease of PEDV in complex with AVI8122 | Authors: | Chen, P., Lu, J., Lemieux, M.J. | Deposition date: | 2025-02-11 |
|
PDBID: | 9n9u | Status: | HPUB -- hold until publication | Title: | Camel alphacoronavirus (229E-like) Nsp5 in complex with AVI8122 | Authors: | Chen, P., Lu, J., Lemieux, M.J. | Deposition date: | 2025-02-11 |
|
PDBID: | 9n9v | Status: | HPUB -- hold until publication | Title: | Main protease of MERS in complex with AVI8122 | Authors: | Chen, P., Lu, J., Lemieux, M.J. | Deposition date: | 2025-02-11 |
|
PDBID: | 9na0 | Status: | HPUB -- hold until publication | Title: | Main protease of HKU8 in complex with AVI8122 | Authors: | Chen, P., Lu, J., Lemieux, M.J. | Deposition date: | 2025-02-11 |
|
PDBID: | 9n9m | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-11 |
|
PDBID: | 9n9q | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-11 |
|
PDBID: | 9n9o | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-11 |
|
PDBID: | 9n9w | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of AMPPNP bound human phosphoribosylformylglycinamidine synthase | Authors: | Sharma, N., French, J.B. | Deposition date: | 2025-02-11 |
|
PDBID: | 9n9n | Status: | HPUB -- hold until publication | Title: | Crystal structure of KRAS(G12C) bound to the cyclic peptide UNC10415730A | Authors: | Rossman, K.L. | Deposition date: | 2025-02-11 |
|
PDBID: | 9n9p | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-11 |
|
PDBID: | 9n9k | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-11 |
|
PDBID: | 9nab | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the alpha5beta1 integrin headpiece with OS2966 Fab | Authors: | Wang, L., Zhang, C. | Deposition date: | 2025-02-11 |
|
PDBID: | 9na4 | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-11 |
|
PDBID: | 9na2 | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-11 |
|
PDBID: | 9na6 | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-11 |
|
PDBID: | 9na5 | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-11 |
|
PDBID: | 9na3 | Status: | HPUB -- hold until publication | Deposition date: | 2025-02-11 |
|
PDBID: | 9n9y | Status: | HPUB -- hold until publication | Title: | Crystal structure of truncated USP1:UAF1 in complex with compound 18 | Authors: | Whittington, D.A. | Deposition date: | 2025-02-11 |
|
PDBID: | 9na1 | Status: | HPUB -- hold until publication | Title: | RNA scaffold | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-11 |
|
PDBID: | 9n9x | Status: | HPUB -- hold until publication | Title: | Structure of HPK1 with C5 bound at its active site | Authors: | Kiefer, J.R., Wang, W., Wu, P., Walters, B.T., Dou, Y. | Deposition date: | 2025-02-11 |
|
PDBID: | 9nad | Status: | HPUB -- hold until publication | Title: | Human GSTO1-1 complexed with C5-1 | Authors: | Oakley, A.J. | Deposition date: | 2025-02-11 | Sequence: | >Entity 1 SGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
|
|
PDBID: | 9na7 | Status: | HPUB -- hold until publication | Title: | RNA scaffold | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-11 |
|