| PDBID: | 9iay | | Status: | HPUB -- hold until publication | | Title: | Structure of 10 in complex with GDP-KRAS | | Authors: | Boettcher, J. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ib4 | | Status: | HPUB -- hold until publication | | Title: | Structure of 12 in complex with GDP-KRAS | | Authors: | Boettcher, J. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ib5 | | Status: | HPUB -- hold until publication | | Title: | Structure of 18 (BI-2493) in complex with GDP-KRAS | | Authors: | Boettcher, J. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Main protease of PEDV in complex with AVI8122 | | Authors: | Chen, P., Lu, J., Lemieux, M.J. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9u | | Status: | HPUB -- hold until publication | | Title: | Camel alphacoronavirus (229E-like) Nsp5 in complex with AVI8122 | | Authors: | Chen, P., Lu, J., Lemieux, M.J. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9v | | Status: | HPUB -- hold until publication | | Title: | Main protease of MERS in complex with AVI8122 | | Authors: | Chen, P., Lu, J., Lemieux, M.J. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na0 | | Status: | HPUB -- hold until publication | | Title: | Main protease of HKU8 in complex with AVI8122 | | Authors: | Chen, P., Lu, J., Lemieux, M.J. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9w | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of AMPPNP bound human phosphoribosylformylglycinamidine synthase | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRAS(G12C) bound to the cyclic peptide UNC10415730A | | Authors: | Rossman, K.L. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9nab | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the alpha5beta1 integrin headpiece with OS2966 Fab | | Authors: | Wang, L., Zhang, C. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of truncated USP1:UAF1 in complex with compound 18 | | Authors: | Whittington, D.A. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na1 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9x | | Status: | HPUB -- hold until publication | | Title: | Structure of HPK1 with C5 bound at its active site | | Authors: | Kiefer, J.R., Wang, W., Wu, P., Walters, B.T., Dou, Y. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9nad | | Status: | HPUB -- hold until publication | | Title: | Human GSTO1-1 complexed with C5-1 | | Authors: | Oakley, A.J. | | Deposition date: | 2025-02-11 | | Sequence: | >Entity 1
SGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
|
|
| PDBID: | 9na7 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
