PDBID: | 9e0n | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9e0o | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9e0q | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9e0r | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of a single nucleosome (1) focus of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome | Authors: | Xie, X., Zhou, X.E., Worden, E.J., Jones, P.A. | Deposition date: | 2024-10-18 |
|
PDBID: | 9e0j | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9e0k | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9e0s | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of a the periplasmic insert from Myxococcus TAtC | Authors: | Deme, J.C., Bryant, O.J., Berks, B.C., Lea, S.M. | Deposition date: | 2024-10-18 | Sequence: | >Entity 1 (MSE)GS(MSE)FTFLLNEEETLALEQRLDTARLRADDALRFLRLGEAEEAGRIAKETSTQLRAEGQGQAPAPEVAPAASVE(MSE)TGRLDGLGRLLDAASVGYGAQSRGVLRQAVEKRVEAVTAYEKKDFAAAAAA(MSE)DGSASLLAGIAPTRTEELAGLWRLEKELATAHAAHEAARWTRP(MSE)LS(MSE)HEQLSENLYFQ
|
|
PDBID: | 9e0i | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the HKU5-19s RBD bound to the Bos taurus ACE2 receptor | Authors: | Park, Y.J., Seattle Structural Genomics Center for Infectious Disease (SSGCID), Veesler, D. | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2t | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2u | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2s | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2r | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-18 |
|
PDBID: | 9k3f | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the ligand-free human melanocortin receptor 3 (MC3R)-Gs complex | Authors: | Feng, W.B., Zhou, Q.T. | Deposition date: | 2024-10-18 |
|
PDBID: | 9k3h | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the ligand-free human melanocortin receptor 5 (MC5R)-Gs complex | Authors: | Feng, W.B., Zhou, Q.T. | Deposition date: | 2024-10-18 |
|
PDBID: | 9k38 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-18 |
|
PDBID: | 9k39 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-18 |
|
PDBID: | 9k3b | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-18 |
|
PDBID: | 9k36 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-18 |
|
PDBID: | 9k3d | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2x | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2v | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-18 |
|
PDBID: | 9k3a | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2w | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-18 |
|
PDBID: | 9k35 | Status: | HPUB -- hold until publication | Title: | Crystal structure of a (R)-selective transaminase (RTA) from Sphingopyxis sp. | Authors: | Qin, F.Y., Lee, K.M., Wong, K.B., Lee, K.H. | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2q | Status: | AUTH -- processed, waiting for author review and approval | Title: | Preload capsid of phiYY, a prokaryotic dsRNA virus | Authors: | Huyan, Y.N., Meng, G. | Deposition date: | 2024-10-18 |
|