PDBID: | 8q4y | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-07 |
|
PDBID: | 8q4s | Status: | HPUB -- hold until publication | Title: | Crystal structure of phosphoserine phosphatase (SerB) from Brucella melitensis in complex with AP4 and magnesium. | Authors: | Scaillet, T., Wouters, J. | Deposition date: | 2023-08-07 |
|
PDBID: | 8kcj | Status: | HPUB -- hold until publication | Title: | De novo design protein -N7 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-07 |
|
PDBID: | 8kck | Status: | HPUB -- hold until publication | Title: | De novo design protein -N9 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-07 | Sequence: | >Entity 1 GAEAAAAAAVTAELRAFRAAGGTVELEDLPVTPETLARAEAALARLPPESVAVETYTVPAPTPEAFLAALEAALARLAAEGLPAILLRVVDADGNLVGSILVAAAGPPAESAAATGRVLTIYVASSPEGLKVARGLAIETRDAGGLALAIGASGAWALAGLAGALALARRLAEAHGAPVRVVTIGDPANPTDAALAAAIRAAYAAALEHHHHHH
|
|
PDBID: | 8tqh | Status: | HPUB -- hold until publication | Title: | MPI68 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-07 |
|
PDBID: | 8tqf | Status: | HPUB -- hold until publication | Title: | Crystal structure of Soybean SHMT8 in complex with PLP-glycine and diglutamylated 5-formyltetrahydrofolate | Authors: | Owuocha, L.F., Beamer, L.J. | Deposition date: | 2023-08-07 |
|
PDBID: | 8tqj | Status: | HPUB -- hold until publication | Title: | MPI57 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-07 |
|
PDBID: | 8tql | Status: | HPUB -- hold until publication | Title: | MPI54 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-07 |
|
PDBID: | 8q4f | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-06 |
|
PDBID: | 8q4c | Status: | AUCO -- author corrections pending review | Title: | Human PEX5 TPR domain in complex with PEX14 KIPSWQIPV peptide | Authors: | Emmanouilidis, L., Gaussmann, S., Sattler, M. | Deposition date: | 2023-08-06 |
|
PDBID: | 8kc9 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-06 | Release date: | 2025-02-06 |
|
PDBID: | 8tq4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tq5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tq6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tq2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tqc | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8q4b | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-05 |
|
PDBID: | 8tpu | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-05 |
|
PDBID: | 8kbu | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 | Release date: | 2025-02-04 |
|
PDBID: | 8q3i | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 |
|
PDBID: | 8q3j | Status: | HPUB -- hold until publication | Title: | Crystal structure of mIL-38 in complex with a neutralizing Fab e04 fragment | Authors: | Garcia-Pardo, J., Da Silva, P., Mora, J., Wiechmann, S., Putyrski, M., You, X., Kannt, A., Ernst, A., Brune, B., Weigert, A. | Deposition date: | 2023-08-04 |
|
PDBID: | 8q3d | Status: | HPUB -- hold until publication | Title: | HsNMT1 in complex with both MyrCoA and GNCFSKPR(NH2) inhibitor peptide | Authors: | Dian, C., Giglione, C., Meinnel, T. | Deposition date: | 2023-08-04 |
|
PDBID: | 8kbc | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-08-04 | Release date: | 2024-08-04 |
|
PDBID: | 8kbn | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 | Release date: | 2025-02-04 |
|
PDBID: | 8kbo | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 | Release date: | 2025-02-04 |
|