| PDBID: | 9kd0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-02 |
|
| PDBID: | 9kd1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-02 |
|
| PDBID: | 9kd2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-02 |
|
| PDBID: | 9kcy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Sorghum bicolor SPS complexed with YH24773 | | Authors: | Xiao, H., Li, M., Yang, G.-F. | | Deposition date: | 2024-11-02 |
|
| PDBID: | 9kcs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Tagatose 4-epimerase with one glycerol from Thermoprotei archaeon | | Authors: | Chen, J., Luo, G., Huang, Z., Ni, D., Zhu, Y., Xu, W., Zhang, W., Mu, W. | | Deposition date: | 2024-11-02 |
|
| PDBID: | 9kct | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Tagatose 4-epimerase from Thermoprotei archaeon | | Authors: | Chen, J., Luo, G., Huang, Z., Ni, D., Zhu, Y., Xu, W., Zhang, W., Mu, W. | | Deposition date: | 2024-11-02 |
|
| PDBID: | 9kcq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of an ankyrin protein in complex with G-quadruplex | | Authors: | Ngo, K.H., Heddi, B., Winnerdy, F.R., Phan, A.T. | | Deposition date: | 2024-11-02 |
|
| PDBID: | 9kcu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-02 |
|
| PDBID: | 9kcv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-02 |
|
| PDBID: | 9kd3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thioredoxin gluthathione reductase from Schistosoma japonicum with the U597C mutation in complex with NADPH | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-02 |
|
| PDBID: | 9kcr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-02 |
|
| PDBID: | 9h9x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of metal-free LmrR_V15Bpy in a closed state | | Authors: | Thunnissen, A.M.W.H., Jiang, R., Casilli, F., Aalbers, F., Roelfes, G. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9h9w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of metal-free LmrR_V15Bpy in an open state | | Authors: | Thunnissen, A.M.W.H., Jiang, R., Casilli, F., Aalbers, F., Roelfes, G. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9h9y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of metal-free LmrR_V15Bpy variant BVS in a closed state | | Authors: | Thunnissen, A.M.W.H., Jiang, R., Casilli, F., Aalbers, F., Roelfes, G. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9h9z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Cu(II)-bound LmrR_V15Bpy | | Authors: | Thunnissen, A.M.W.H., Jiang, R., Casilli, F., Aalbers, F., Roelfes, G. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9ha0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Cu(II)-bound LmrR_V15Bpy variant BVS | | Authors: | Thunnissen, A.M.W.H., Jiang, R., Casilli, F., Aalbers, F., Roelfes, G. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e7i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e78 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e7k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e7h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e77 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CSN-N8 in complex with CSN5i-3 | | Authors: | Shi, H., Zheng, N. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e7d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HIV-1 RRE SLII A31C mutant in complex with Fab BL3-6 | | Authors: | Ojha, M., Koirala, D. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e79 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the MIR domain of the S. cerevisiae mannosyltransferase Pmt4 | | Authors: | Du, M., Yuan, Z., Li, H. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e7a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the MIR domain of the S. cerevisiae mannosyltransferase Pmt4 in Complex with Ccw5 | | Authors: | Du, M., Yuan, Z., Li, H. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9e7b | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186G covalently bound to compound GRL-051-22 at 1.3 A | | Authors: | Beechboard, S.B., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-11-01 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFGDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
