| PDBID: | 9k87 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced icosahedron Cage-i53-Zn1-HEHE-5 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k89 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced icosahedron Cage-i53-Zn1-HEHE-6 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of C3 symmetric interface of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-34 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7q | | Status: | HPUB -- hold until publication | | Title: | Parkinson disease protein 7 (DJ-1) and Alpha-synuclein (Alpha-syn) complex | | Authors: | Han, C.W., Kim, D.H. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8e | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-35 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8k | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of C2 symmetric interface of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-36 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8l | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of C3 symmetric interface of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-36 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k88 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8s | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of HE30 polymorph 1 | | Authors: | Xia, W.C., Liu, C. | | Deposition date: | 2024-10-24 | | Release date: | 2025-10-24 |
|
| PDBID: | 9k8t | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of HE30 polymorph 2 | | Authors: | Xia, W.C., Liu, C. | | Deposition date: | 2024-10-24 | | Release date: | 2025-10-24 |
|
| PDBID: | 9k82 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced filament Fiber-n5-Zn1-HEHE-917 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7y | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced icosahedron Cage-i53-Zn1-HEHE-14 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7z | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced icosahedron Cage-i53-Zn1-HEHE-16 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k80 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced filament Fiber-n6-Zn1-HEHE-5 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k81 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced filament Fiber-n7-Zn1-HEHE-74 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k83 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced filament Fiber-n6-Zn1-HEHE-43 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of designed calcium-induced homotrimer C3-Ca1-DN*3-20 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8a | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-34 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8b | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of monomer of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-34 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8c | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of C2 symmetric interface of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-34 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 | | Sequence: | >Entity 1
MGHHHHHHHHSSGLEVLFQGPGGTMEKLKEIVKHLEVAIKYLKEGKVDLADLVVADAIELAKEAGDKASLEILKVAHKAIDTLGREGKLEEAAKIVKYAKEYVEAKIKGDREKLRELLEKVKKDVLEAIKKGDEEFYEALVKIARIIAEDLGDEKSLKVLEALEEFFKEWKRLEKEGKSLDEKLHLFLRVGERLLEIGDKESLEMLIELLEELAKEIKKAGNEELLVRAEAAIKDIRKHIKEL
|
|
| PDBID: | 9k8f | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of monomer of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-35 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of C3 symmetric interface of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-35 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8h | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of C2 symmetric interface of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-35 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
