| PDBID: | 9h03 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h04 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h05 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h06 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h07 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h08 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h09 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9ju3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 3-fold Block-refine of Full particle of phiYY, a prokaryotic dsRNA virus | | Authors: | Meng, K.W., Cui, C.X., HuYan, Y.N., Zhang, X.Z., Meng, G. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9juc | | Status: | HPUB -- hold until publication | | Title: | crystal structure of swine MHC class I for 2.30 Angstorm | | Authors: | Tian, P.P., Wu, Y.N. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9ju8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9jts | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9jtt | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Beta-glucosidase from the Indigo-producing Plant Polygonum tinctorium | | Authors: | Yoneda, K., Himeno, M., Sakuraba, H., Ohshima, T. | | Deposition date: | 2024-10-07 | | Sequence: | >Entity 1
LKRTSFPKKFLFGAGSASYQYEGAAHIDGRGLSVWDVFTKEHPEKIADQSNGDVAQDFYHRYKEDIKSMKEMGLESFRFSISWSRILPNGKISGGINKLGIKFYNNLIDELLANGIKPLVTIYHWDLPQALQDEYGGFLSPKIVDDFLEYANLVFKEFGDRVKHWATLNEPNIMTQQGYVFGAHAPGRCSHFEWNCPAGNSGTEPYIVGHHLLLCHAAAFQLYKQKYKDDQKGIIGITTATQMAIPLNDNVANLLAASRAIDFNIGWFLHPVVYGEYPQTMRERLGSRLPKFTEKESEMLKQSFDFIGLNYYSTDYAAASSFSVDPVNVSYTTDSRATLSAIKDGVPIGDPTFMSWLHIYPEGILTLLRYVKERYNNPFVMITENGMADENKGSLAEDPMALKDNVRIRYHREHLYYVLEAIKEGVNVGGYYAWTWMDDFEWGSGYTPRFGLNFVDFDNDLKRTPKDSYFWFKDFLAN
|
|
| PDBID: | 9jtu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9ju0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9jtz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9ju6 | | Status: | HPUB -- hold until publication | | Title: | Tribolium castaneum ABCH-9C in complex with NBD-ceramide(d36:1) | | Authors: | Chen, J., Duan, Y., Zhou, Y., Yang, Q. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9ju9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9ju7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9ju5 | | Status: | HPUB -- hold until publication | | Title: | Structure of aldehyde dehydrogenase SbzJ in complex with NAD+ | | Authors: | He, H., Mori, T., Abe, I. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9jua | | Status: | HPUB -- hold until publication | | Title: | The complex of Eny2B and Sgf11 of Drosophila melanogaster | | Authors: | Boyko, K.M., Bonchuk, A.N., Nikolaeva, A.Y., Arkova, O.V., Belova, E.V., Georgiev, P.G., Popov, V.O. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9dve | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of Kohinoor reversibly switchable fluorescent protein | | Authors: | Richardson, B.C., He, Y., Iuliano, J.N., Woroniecka, H.A., French, J.B. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9dvh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9dvb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9dvc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9dvd | | Status: | HPUB -- hold until publication | | Title: | Cryo EM structure of Hendra G ectodomain in complex with Ephrin-B2 and Fab HENV-270 | | Authors: | Binshtein, E., Crowe, J.E. | | Deposition date: | 2024-10-07 |
|
