| PDBID: | 9e7b | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186G covalently bound to compound GRL-051-22 at 1.3 A | | Authors: | Beechboard, S.N., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-11-01 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFGDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9h9h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Complex 1 30S-IF1-IF2-IF3-GE81112 | | Authors: | Schedlbauer, A., Han, X., van Bakel, W., Kaminishi, T., Ochoa-Lizarralde, B., Iturrioz, I., Capuni, R., Parry, R., Zegarra, R., Gil-Carton, D., Lopez-Alonso, J.P., Barragan Sanz, K., Brandi, L., Gualerzi, C.O., Fucini, P., Connell, S.R. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9h9k | | Status: | HPUB -- hold until publication | | Title: | Complex 3 (HEAD) 30S-tRNA-GE81112 | | Authors: | Schedlbauer, A., Han, X., van Bakel, W., Kaminishi, T., Ochoa-Lizarralde, B., Iturrioz, I., Capuni, R., Parry, R., Zegarra, R., Gil-Carton, D., Lopez-Alonso, J.P., Barragan Sanz, K., Brandi, L., Gualerzi, C.O., Fucini, P., Connell, S.R. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9h9l | | Status: | HPUB -- hold until publication | | Title: | Complex 3 (BODY) 30S-tRNA-GE81112 | | Authors: | Schedlbauer, A., Han, X., van Bakel, W., Kaminishi, T., Ochoa-Lizarralde, B., Iturrioz, I., Capuni, R., Parry, R., Zegarra, R., Gil-Carton, D., Lopez-Alonso, J.P., Barragan Sanz, K., Brandi, L., Gualerzi, C.O., Fucini, P., Connell, S.R. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9h9m | | Status: | HPUB -- hold until publication | | Title: | Complex 4 (HEAD) 30S-GE81112 (weak residual tRNA) | | Authors: | Schedlbauer, A., Han, X., van Bakel, W., Kaminishi, T., Ochoa-Lizarralde, B., Iturrioz, I., Capuni, R., Parry, R., Zegarra, R., Gil-Carton, D., Lopez-Alonso, J.P., Barragan Sanz, K., Brandi, L., Gualerzi, C.O., Fucini, P., Connell, S.R. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9h9v | | Status: | HPUB -- hold until publication | | Title: | BabyBass soluble domain | | Authors: | Kauffmann, B. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9kbo | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of a host factor Shiftless(SHFL) | | Authors: | Li, Z., Hao, W., Zhang, Y., Hou, P., Cui, S. | | Deposition date: | 2024-10-31 | | Release date: | 2025-10-31 |
|
| PDBID: | 9kbw | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of microtubule bound with GAS2-GAR domain. | | Authors: | An, J., Imasaki, T., Narita, A., Niwa, S., Sasaki, R., Makino, T., Nitta, R., Kikkawa, M. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9kbx | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of F-actin bound with GAS2-CH3 domain. | | Authors: | An, J., Imasaki, T., Narita, A., Niwa, S., Sasaki, R., Makino, T., Nitta, R., Kikkawa, M. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9kc1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Succinate dehydrogenase of Fusarium graminearum | | Authors: | Feng, Z.Y., Gong, H.R. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9kbz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9kby | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9kbk | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the SPS3-FBN5 complex in a 2:2 state (class 3) | | Authors: | Xiao, H., Wang, Y.-W., Zhu, P., Yang, G.-F. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9kbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9kc3 | | Status: | HPUB -- hold until publication | | Title: | The structure of succinate dehydrogenase of Purpureocillium lilacinum with Isofetamid | | Authors: | Yu, L., Gong, H.R. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9kc2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of ZSQ07-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9kbu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9kbl | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of T2R-TTL-IKP104 | | Authors: | Yan, W., Yang, J. | | Deposition date: | 2024-10-31 | | Release date: | 2025-10-31 |
|
| PDBID: | 9kbn | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of T2R-TTL-IKP104-Colchicine | | Authors: | Yan, W., Yang, J.H. | | Deposition date: | 2024-10-31 | | Release date: | 2025-10-31 |
|
| PDBID: | 9kc4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9kc0 | | Status: | HPUB -- hold until publication | | Title: | The structure of succinate dehydrogenase of Purpureocillium lilacinum with Pydiflumetofen | | Authors: | Yu, L., Gong, H.r. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9kbm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9e72 | | Status: | HPUB -- hold until publication | | Title: | HvrF methyltransferase with SAH and pantaphos | | Authors: | Kuzelka, K.P., Nair, S.K. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9e6w | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9e6v | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae Pmt4-Ccw5 complex | | Authors: | Du, M., Yuan, Z., Li, H. | | Deposition date: | 2024-10-31 |
|
