| PDBID: | 9hf3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hf2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hf1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hf0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hez | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hey | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hex | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hew | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hev | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9het | | Status: | HPUB -- hold until publication | | Title: | MscS1Q78W from Halomonas elongata | | Authors: | Fischer, F., Ziegler, C. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hef | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9heo | | Status: | HPUB -- hold until publication | | Title: | Open-state RyR1 in 0.05% POPC micelles, in complex with a nanobody and FKBP | | Authors: | Li, C., Efremov, R.G. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9heu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9heq | | Status: | HPUB -- hold until publication | | Title: | Open-state RyR1 in 0.01% POPC micelles, in complex with a nanobody and FKBP12 | | Authors: | Li, C., Efremov, R.G. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hes | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hei | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9heg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hem | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9heh | | Status: | HPUB -- hold until publication | | Title: | Structure of the ligand binding domain of the chemoreceptor MkcA (DSOMK10_RS0100305) of Dickeya solani MK10 in complex with choline | | Authors: | Gavira, J.A., Rico-Jimenez, M., Matilla, M.A. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hen | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kks | | Status: | HOLD -- hold until a certain date | | Title: | Solution NMR structure of Pseudoazurin | | Authors: | Yamaguchi, T., Obara, Y., Fujikawa, K., Yamasaki, K., Kohzuma, T. | | Deposition date: | 2024-11-14 | | Release date: | 2025-11-14 | | Sequence: | >Entity 1
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
|
|
| PDBID: | 9kl3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pleurocybella porrigens lectin (PPL) in complex with GalNAc | | Authors: | Adachi, D., Ishimoto, N., Kawabata, H., Mizutani, K., Park, S.-Y., Tame, J.R.H., Kamata, K. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9klm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
