| PDBID: | 9ktv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ktw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ktx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9kuf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of HsClpP bound to CLPP-2068 | | Authors: | Zhao, H., Yuan, Q., Yin, W. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9eko | | Status: | HPUB -- hold until publication | | Title: | A chimeric hybrid protein fused with the FGFR3 Transmembrane Domain | | Authors: | Yu, Z., Kreitler, D.F., Gellman, S.H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekr | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) R136W in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of WDR55 in complex with XS381774 | | Authors: | Chen, U.H., Li, F., Zeng, H., Ahmad, H., Wang, X., Sun, J., Dong, A., Seitova, A., Arrowsmith, C.H., Edwards, A.M., Peng, H., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-12-03 | | Sequence: | >Entity 1
SMEAPTRIRDTPEDIVLEAPASGLAFHPARDLLAAGDVDGDVFVFSYSCQEGETKELWSSGHHLKACRAVAFSEDGQKLITVSKDKAIHVLDVEQGQLERRVSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDD
|
|
| PDBID: | 9el2 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T151I in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9el3 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T164A in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hjx | | Status: | HPUB -- hold until publication | | Title: | Structure of the Thermus termophillus transhydrogenase | | Authors: | Trasnea, P.I., Sazanov, L. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9hk2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9hjy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kt9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kt8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kt7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kt6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kta | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktn | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of SARS-CoV-2 nsp10-nsp16 methyltransferase complex with MI54 | | Authors: | Cao, L., Xu, T.F., Yan, L.M., Yang, S.D., Zhang, H.W., Ji, Y.X., Ge, J., Fan, S.L., Li, C.M., Rao, Z.H., Lou, Z.Y., Guo, D.Y. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktt | | Status: | HPUB -- hold until publication | | Title: | Structure of TauT in complex with taurine | | Authors: | Yin, Y.X., Lu, Y.S., Ding, D. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kte | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
