| PDBID: | 9ds6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9dsa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9drw | | Status: | HPUB -- hold until publication | | Title: | Myocilin OLF mutant A427T | | Authors: | Scelsi, H.F., Lieberman, R.L. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
LKESPSGYLRSGEGDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVTNAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSKM
|
|
| PDBID: | 9drr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9drt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex of M. tuberculosis PheRS with cognate precursor tRNA and fragment DDD00805735 | | Authors: | Chang, C., Michalska, K., Forte, B., Baragana, B., Gilbert, I.H., Wower, J., Joachimiak, A., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9ds3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Apo-241_2F04 Fab | | Authors: | Lin, T.H., Wilson, I.A. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gvn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | DEPEMOKIMAB FAB IN COMPLEX WITH INTERLEUKIN 5 | | Authors: | Somers, D.O. | | Deposition date: | 2024-09-25 | | Release date: | 2025-09-25 |
|
| PDBID: | 9gvo | | Status: | HPUB -- hold until publication | | Title: | type-I interferons autoantibodies pmab15 and pmab14 in complex with Interferon alpha-2 | | Authors: | Duquerroy, S., Rey, F., Ahouzi, O., Mahevas, M., Chappert, P. | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9gvp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9gvs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9gvu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9gvt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9gvr | | Status: | HPUB -- hold until publication | | Title: | mEos4b-L93M photoconvertible fluorescent protein | | Authors: | Adam, V. | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9gvv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9gvl | | Status: | HPUB -- hold until publication | | Title: | type-I interferons autoantibody pmab15 in complex with Interferon alpha-2 | | Authors: | Duquerroy, S., Rey, F., Mahevas, M., Chappert, P., Ahouzi, O. | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9jot | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Imp-beta in complex with the NLS of NFAT5 | | Authors: | Zhao, Y., Zhang, S., Zheng, S. | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9jox | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9jow | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9jov | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-25 |
|
