| PDBID: | 8s14 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 | | Release date: | 2025-08-15 |
|
| PDBID: | 8s15 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 | | Release date: | 2025-08-15 |
|
| PDBID: | 8s17 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 | | Release date: | 2025-08-15 |
|
| PDBID: | 8s16 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 | | Release date: | 2025-08-15 |
|
| PDBID: | 8s18 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 | | Release date: | 2025-08-15 |
|
| PDBID: | 8s19 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 | | Release date: | 2025-08-15 |
|
| PDBID: | 8s1a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 | | Release date: | 2025-08-15 |
|
| PDBID: | 8s1e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 | | Release date: | 2025-08-15 |
|
| PDBID: | 8s1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 | | Release date: | 2025-08-15 |
|
| PDBID: | 8s1d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the influenza A matrix protein 1 peptide 100-114 in complex with HLA-DRB1*04:04 | | Authors: | Sharma, R.K., Dubnovitsky, A., Gerstner, C., Boddul, S., James, T., Turcinov, S., Horuluoglu, B., Andriopoulos, P., Kozhukh, G., Achour, A., Wermeling, F., Kwok, W.W., Ronnblom, L., Klareskog, L., James, E., Padyukov, L., Malmstrom, V. | | Deposition date: | 2024-02-15 | | Release date: | 2025-08-15 |
|
| PDBID: | 8s1f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 | | Release date: | 2025-08-15 |
|
| PDBID: | 8s1l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 | | Release date: | 2025-08-15 |
|
| PDBID: | 8s0g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-14 | | Release date: | 2025-08-14 |
|
| PDBID: | 8ybi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-14 | | Release date: | 2025-08-14 |
|
| PDBID: | 8rzz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 | | Release date: | 2025-08-13 | | Sequence: | >Entity 1
MDLAKLGLKEVMPTKINLEGLVGDHAFSMEGVGEGNILEGTQEVKISVTKGAPLPFAFDIVSVAF(CRO)NRAYTGYPEEISDYFLQSFPEGFTYERNIRYQDGGTAIVKSDISLEDGKFIVNVDFKAKDLRRMGPVMQQDIVGMQPSYESMYTNVTSVIGECIIAFKLQTGKHFTYHMRTVYKSKKPVETMPLYHFIQHRLVKTNVDTASGYVVQHETAIAAHSTIKKIEGSLP
>Entity 2
MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAKKFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQSGLEVLFQ
|
|
| PDBID: | 8s05 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | ArnAB complex an archaeal ortholog of the Sec23/24 core motif | | Authors: | Korf, L., Steinchen, W., Watad, M., Bezold, F., Vogt, M.S., Selbach, L., Penner, A., Tourte, M., Hepp, S., Albers, S.V., Essen, L.-O. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8vzw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of humanized MS-Hu6 Fab fragment | | Authors: | Misra, A., Schuermann, J., Gupta, Y.K., Mone, Z. | | Deposition date: | 2024-02-12 |
|
| PDBID: | 8yba | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-12 | | Release date: | 2025-08-12 |
|
| PDBID: | 8yb9 | | Status: | HPUB -- hold until publication | | Title: | Yeast NPC pre-60S assembly intermediate (state C13) | | Authors: | Chen, S.J.B., Sui, S.F. | | Deposition date: | 2024-02-12 | | Release date: | 2025-08-12 |
|
| PDBID: | 8vyz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of modified Zika virus E protein dimer complexed with a neutralizing antibody OZ-D4 Fab | | Authors: | Galkin, A., Pozharski, E., Li, Y. | | Deposition date: | 2024-02-09 | | Release date: | 2025-08-08 |
|
| PDBID: | 8yae | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-09 | | Release date: | 2025-08-09 |
|
| PDBID: | 8yao | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-09 | | Release date: | 2025-08-09 |
|
| PDBID: | 8vyh | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure Analysis of PARP1 in complex with a compound | | Authors: | Seo, H.-S., Dhe-Paganon, S., Arthanari, H. | | Deposition date: | 2024-02-08 |
|
| PDBID: | 8ry5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-08 | | Release date: | 2025-08-08 |
|
| PDBID: | 8ry3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-08 | | Release date: | 2025-08-08 |
|
